DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment bark and Loxl3

DIOPT Version :9

Sequence 1:	NP_001245864.1	Gene:	bark / 33604	FlyBaseID:	FBgn0031571	Length:	3123	Species:	Drosophila melanogaster
Sequence 2:	NP_038614.2	Gene:	Loxl3 / 16950	MGIID:	1337004	Length:	754	Species:	Mus musculus

Alignment Length:	121	Identity:	43/121 - (35%)
Similarity:	62/121 - (51%)	Gaps:	13/121 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly  1071 VRLVGGAGANEGRLQVYLKGRWGTVCDYGWNVLNAALVCHQLGYSLNPQDWRLLRSQLPNAGTSE 1135
            |||.|||...|||::|...|.||||||..|::..|::||.:||:.       ..|..|..|...:
Mouse   308 VRLKGGAHQGEGRVEVLKAGTWGTVCDRKWDLQAASVVCRELGFG-------TAREALSGARMGQ 365

  Fly  1136 D---ILMANVRCTLQDRDVTKCRAEYEFENTCSHENDVGLRC---YEGAWAGVRFS 1185
            .   |.::.|||:.|:..:.:|.::......|||..|.|:||   |.|....:|.|
Mouse   366 GMGAIHLSEVRCSGQEPSLWRCPSKNITAEDCSHSQDAGVRCNLPYTGVETKIRLS 421

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
bark	NP_001245864.1	SR	191..295	CDD:214555
		SRCR	196..294	CDD:278931
		CUB	459..552	CDD:238001
		Beta_helix	579..752	CDD:289971
		SR	1071..1175	CDD:214555	39/109 (36%)
		SRCR	1076..1174	CDD:278931	33/100 (33%)
		SR	1932..2037	CDD:214555
		SRCR	1932..2037	CDD:278931
		CLECT	2604..2699	CDD:214480
Loxl3	NP_038614.2	SR	46..145	CDD:214555
		SRCR	54..146	CDD:278931
		SR	170..282	CDD:214555
		SRCR	187..282	CDD:278931
		SR	308..408	CDD:214555	38/106 (36%)
		SRCR	313..408	CDD:278931	34/101 (34%)
		SR	418..526	CDD:214555	2/4 (50%)
		SRCR	423..526	CDD:278931
		Lysyl-oxidase like	530..733
		Lysyl_oxidase	531..725	CDD:279521
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S6743
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.950