DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment bowl and MSN4

DIOPT Version :9

Sequence 1:	NP_001245861.1	Gene:	bowl / 33602	FlyBaseID:	FBgn0004893	Length:	744	Species:	Drosophila melanogaster
Sequence 2:	NP_012861.1	Gene:	MSN4 / 853803	SGDID:	S000001545	Length:	630	Species:	Saccharomyces cerevisiae

Alignment Length:	94	Identity:	28/94 - (29%)
Similarity:	38/94 - (40%)	Gaps:	29/94 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly   255 IHERTHTDERPYSCDICGKAFRRQDHLRDH-RYIHSKEKPFKCTECGKGFCQSRTLAVHKILHME 318
            |....:...:|:.|..|.|||||.:||:.| |.:||.|:||.|.
Yeast   562 IDPNNYDKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACM--------------------- 605

  Fly   319 ESPHKCPVCSRSFNQRSNLKTHLLTHTDH 347
                   .|.:.|::..||..||.||..|
Yeast   606 -------FCEKKFSRSDNLSQHLKTHKKH 627

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
bowl	NP_001245861.1	COG5048	<232..372	CDD:227381	28/94 (30%)
		C2H2 Zn finger	240..260	CDD:275368	1/4 (25%)
		zf-H2C2_2	252..277	CDD:290200	7/21 (33%)
		C2H2 Zn finger	268..288	CDD:275368	11/20 (55%)
		zf-H2C2_2	280..303	CDD:290200	10/23 (43%)
		C2H2 Zn finger	296..316	CDD:275368	1/19 (5%)
		zf-C2H2	322..344	CDD:278523	6/21 (29%)
		C2H2 Zn finger	324..344	CDD:275368	6/19 (32%)
		zf-H2C2_2	336..361	CDD:290200	7/12 (58%)
		C2H2 Zn finger	352..372	CDD:275368
MSN4	NP_012861.1	COG5048	57..622	CDD:227381	24/87 (28%)
		C2H2 Zn finger	575..596	CDD:275368	11/20 (55%)
		C2H2 Zn finger	604..624	CDD:275368	7/47 (15%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R2698
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030