DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bowl and egr4

DIOPT Version :9

Sequence 1:NP_001245861.1 Gene:bowl / 33602 FlyBaseID:FBgn0004893 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_001107925.1 Gene:egr4 / 795099 ZFINID:ZDB-GENE-080204-90 Length:352 Species:Danio rerio


Alignment Length:188 Identity:57/188 - (30%)
Similarity:77/188 - (40%) Gaps:20/188 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 PGGPGGPGVPPPGVLYGPAGVPPPPYLTGPGPSPTGAGSFPFPPGAAAAALFPPGLGPGMHAGLD 221
            |.||....|....:...|.....|   ..|.||...:....||.....|......|....||  .
Zfish   175 PLGPETDSVLDTWIKQEPLDFQLP---VAPAPSHENSLYISFPNAFGLADALDSLLATNTHA--Q 234

  Fly   222 RRLLRAPGRASRPKKQFIC--KFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDH 284
            |...||...|:| :|.|.|  :.|.|:|::|..|..|.|.||..:|:.|.:|.:.|.|.|||..|
Zfish   235 RSKPRARKGAAR-EKPFSCPVESCERRFSRSDELNRHVRIHTGHKPFQCRVCLRCFSRSDHLTTH 298

  Fly   285 RYIHSKEKPFKCTECGKGFCQSRTLAVHKILHMEESPHKCPVCSRSFNQRSNLKTHLL 342
            ...|:.||||.|..|.:.|.:|.....|..:|:::            .:|...||.||
Zfish   299 MRTHTGEKPFSCDVCARRFARSDERKRHMRVHLKQ------------RERMQQKTELL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bowlNP_001245861.1 COG5048 <232..372 CDD:227381 38/113 (34%)
C2H2 Zn finger 240..260 CDD:275368 8/21 (38%)
zf-H2C2_2 252..277 CDD:290200 9/24 (38%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
zf-H2C2_2 280..303 CDD:290200 10/22 (45%)
C2H2 Zn finger 296..316 CDD:275368 5/19 (26%)
zf-C2H2 322..344 CDD:278523 5/21 (24%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
zf-H2C2_2 336..361 CDD:290200 4/7 (57%)
C2H2 Zn finger 352..372 CDD:275368
egr4NP_001107925.1 COG5048 229..>311 CDD:227381 33/84 (39%)
C2H2 Zn finger 252..274 CDD:275368 8/21 (38%)
zf-H2C2_2 266..291 CDD:290200 9/24 (38%)
COG5048 278..>344 CDD:227381 23/77 (30%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-H2C2_2 294..319 CDD:290200 11/24 (46%)
C2H2 Zn finger 310..330 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.