| Sequence 1: | NP_001245861.1 | Gene: | bowl / 33602 | FlyBaseID: | FBgn0004893 | Length: | 744 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006506534.1 | Gene: | Klf15 / 66277 | MGIID: | 1929988 | Length: | 520 | Species: | Mus musculus |
| Alignment Length: | 333 | Identity: | 90/333 - (27%) |
|---|---|---|---|
| Similarity: | 125/333 - (37%) | Gaps: | 65/333 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 54 GSGGSDGGSQNGNGDSRNSSASRIS--AYETQLAYQQHLAGLHGPPPPPPPSHHREISAFVPVLP 116
Fly 117 TGKVR--PGSNS-NYEIIAMMADKRKELALREAAAAAAMLGRGPGGPGGPGVPPPGVLYGPAGVP 178
Fly 179 PPPYL--TGPGPSPTGAGSFPFPPGAAAAAL---------------FPPGLGPGMHAGLDRRLLR 226
Fly 227 ----------------APGRASR------PK-------KQFICKF--CNRQFTKSYNLLIHERTH 260
Fly 261 TDERPYSCDI--CGKAFRRQDHLRDHRYIHSKEKPFKCTECGKGFCQSRTLAVH-KILHMEESPH 322
Fly 323 KCPVCSRS 330 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| bowl | NP_001245861.1 | COG5048 | <232..372 | CDD:227381 | 41/117 (35%) |
| C2H2 Zn finger | 240..260 | CDD:275368 | 9/21 (43%) | ||
| zf-H2C2_2 | 252..277 | CDD:290200 | 11/26 (42%) | ||
| C2H2 Zn finger | 268..288 | CDD:275368 | 9/21 (43%) | ||
| zf-H2C2_2 | 280..303 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 296..316 | CDD:275368 | 8/20 (40%) | ||
| zf-C2H2 | 322..344 | CDD:278523 | 4/9 (44%) | ||
| C2H2 Zn finger | 324..344 | CDD:275368 | 3/7 (43%) | ||
| zf-H2C2_2 | 336..361 | CDD:290200 | |||
| C2H2 Zn finger | 352..372 | CDD:275368 | |||
| Klf15 | XP_006506534.1 | SFP1 | <423..505 | CDD:227516 | 34/81 (42%) |
| C2H2 Zn finger | 427..449 | CDD:275368 | 9/21 (43%) | ||
| C2H2 Zn finger | 457..479 | CDD:275368 | 9/21 (43%) | ||
| zf-H2C2_2 | 471..496 | CDD:372612 | 11/24 (46%) | ||
| C2H2 Zn finger | 487..507 | CDD:275368 | 8/26 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2698 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.030 | |||||