DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bowl and ZBTB2

DIOPT Version :9

Sequence 1:NP_001245861.1 Gene:bowl / 33602 FlyBaseID:FBgn0004893 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_065912.1 Gene:ZBTB2 / 57621 HGNCID:20868 Length:514 Species:Homo sapiens


Alignment Length:418 Identity:97/418 - (23%)
Similarity:141/418 - (33%) Gaps:170/418 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 KVRPGSNSNYEIIAMMADKRKELALREA---AAAAAMLGRGPGGPGG------------------ 162
            :|.|.::|.|.|  .:||.:    ||:|   |:|...|||.|.....                  
Human   124 QVFPLASSLYGI--QIADHQ----LRQATKIASAPEKLGRDPRPQTSRISQEQVPEASQLSQLTS 182

  Fly   163 -----------PGVP-----PPGVLYGPAGVPPPPYLTGPGPSPT-GAGSFPFPPGAAAAALFPP 210
                       |..|     .|.::..|  |||||    ||.... .|.|....|.:...|...|
Human   183 NLAQVNRTNMTPSDPLQTSLSPELVSTP--VPPPP----PGEETNLEASSSDEQPASLTIAHVKP 241

  Fly   211 GLGPGMHAGLDRRLLRAPGRASRPKKQFICKFCNRQFTKSYNLLIHERTHT-------------- 261
            .            :::..|  |.| |.:.|..|.|:||...:|..|.:.||              
Human   242 S------------IMKRNG--SFP-KYYACHLCGRRFTLRSSLREHLQIHTGVPFTSSQQGESRV 291

  Fly   262 ----------------------------------------------------------------- 261
                                                                             
Human   292 PLTLCSNAADLGKDAMEVPEAGMISDSELQHISDSPIIDGQQQSETPPPSDIADIDNLEQADQER 356

  Fly   262 --DERPYSCDICGKAFRRQDHLRDHRYIHSKEKPFKCTECGKGFCQSRTLAVHKILHMEESPH-- 322
              ..|.|.|.|||:.|.::.|.|:|.|||: .|||||:.|.|.||::...|.|..|:.....:  
Human   357 EVKRRKYECTICGRKFIQKSHWREHMYIHT-GKPFKCSTCDKSFCRANQAARHVCLNQSIDTYTM 420

  Fly   323 ----KCPVCSRSFNQRSNLKTHLLTHTDHKPYECSSCGKVFRRNCDLRRHALTHAVGEVNSGDYV 383
                ...:|  :|.:.|.: .::|..| :|||:|:.|.|.|....::.:|:..:.    ||    
Human   421 VDKQTLELC--TFEEGSQM-DNMLVQT-NKPYKCNLCDKTFSTPNEVVKHSCQNQ----NS---- 473

  Fly   384 DVGEEDEARNL---SGDEEDSLLEVDSP 408
            ||...||.|::   |||.|  :.|.|.|
Human   474 DVFALDEGRSILLGSGDSE--VTEPDHP 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bowlNP_001245861.1 COG5048 <232..372 CDD:227381 50/226 (22%)
C2H2 Zn finger 240..260 CDD:275368 7/19 (37%)
zf-H2C2_2 252..277 CDD:290200 11/105 (10%)
C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
zf-H2C2_2 280..303 CDD:290200 13/22 (59%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
zf-C2H2 322..344 CDD:278523 4/27 (15%)
C2H2 Zn finger 324..344 CDD:275368 4/19 (21%)
zf-H2C2_2 336..361 CDD:290200 9/24 (38%)
C2H2 Zn finger 352..372 CDD:275368 5/19 (26%)
ZBTB2NP_065912.1 BTB 14..>84 CDD:306997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..231 19/87 (22%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
zf-C2H2 363..385 CDD:306579 10/21 (48%)
C2H2 Zn finger 365..385 CDD:275368 9/19 (47%)
zf-H2C2_2 377..399 CDD:316026 13/22 (59%)
C2H2 Zn finger 392..443 CDD:275368 12/53 (23%)
C2H2 Zn finger 450..466 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5238
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.