DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment bowl and sp2

DIOPT Version :9

Sequence 1:	NP_001245861.1	Gene:	bowl / 33602	FlyBaseID:	FBgn0004893	Length:	744	Species:	Drosophila melanogaster
Sequence 2:	NP_001093452.2	Gene:	sp2 / 556835	ZFINID:	ZDB-GENE-080410-1	Length:	610	Species:	Danio rerio

Alignment Length:	96	Identity:	36/96 - (37%)
Similarity:	50/96 - (52%)	Gaps:	6/96 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   226 RAPGRASRPKKQFICKF--CNRQFTKSYNLLIHERTHTDERPYSCD--ICGKAFRRQDHLRDHRY 286
            :.||...  |::.||..  |.:.|.|:..|..|.|.||.|||:.|:  .|||.|.|.|.|:.|..
Zfish   512 KKPGEVG--KRKHICHIAGCEKTFRKTSLLRAHVRLHTGERPFVCNWVFCGKRFTRSDELQRHAR 574

  Fly   287 IHSKEKPFKCTECGKGFCQSRTLAVHKILHM 317
            .|:.:|.|:|.:|.|.|.:|..|..|...|:
Zfish   575 THTGDKRFECNKCQKRFMRSDHLTKHYKTHI 605

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
bowl	NP_001245861.1	COG5048	<232..372	CDD:227381	34/90 (38%)
		C2H2 Zn finger	240..260	CDD:275368	7/21 (33%)
		zf-H2C2_2	252..277	CDD:290200	13/26 (50%)
		C2H2 Zn finger	268..288	CDD:275368	9/21 (43%)
		zf-H2C2_2	280..303	CDD:290200	8/22 (36%)
		C2H2 Zn finger	296..316	CDD:275368	7/19 (37%)
		zf-C2H2	322..344	CDD:278523
		C2H2 Zn finger	324..344	CDD:275368
		zf-H2C2_2	336..361	CDD:290200
		C2H2 Zn finger	352..372	CDD:275368
sp2	NP_001093452.2	C2H2 Zn finger	524..546	CDD:275368	7/21 (33%)
		COG5048	<529..>584	CDD:227381	23/54 (43%)
		zf-H2C2_2	539..565	CDD:290200	13/25 (52%)
		C2H2 Zn finger	554..576	CDD:275368	9/21 (43%)
		zf-H2C2_2	568..591	CDD:290200	8/22 (36%)
		zf-C2H2	582..604	CDD:278523	8/21 (38%)
		C2H2 Zn finger	584..604	CDD:275368	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R2698
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.030