DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment bowl and drm

DIOPT Version :9

Sequence 1:	NP_001245861.1	Gene:	bowl / 33602	FlyBaseID:	FBgn0004893	Length:	744	Species:	Drosophila melanogaster
Sequence 2:	NP_001285590.1	Gene:	drm / 49638	FlyBaseID:	FBgn0024244	Length:	88	Species:	Drosophila melanogaster

Alignment Length:	74	Identity:	39/74 - (52%)
Similarity:	52/74 - (70%)	Gaps:	8/74 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   230 RASRPKKQFICKFCNRQFTKSYNLLIHERTH-TDERPYSCDICGKAFRRQDHLRDHRYIHSKEKP 293
            |..|||.:||||:|.|:|||.|||:|||||| :.|..|||::|||.|:::|:||.||.:|
  Fly    18 RKMRPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRNLH----- 77

  Fly   294 FKCTECGKG 302
              ...||:|
  Fly    78 --MDTCGRG 84

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
bowl	NP_001245861.1	COG5048	<232..372	CDD:227381	38/72 (53%)
		C2H2 Zn finger	240..260	CDD:275368	14/19 (74%)
		zf-H2C2_2	252..277	CDD:290200	16/25 (64%)
		C2H2 Zn finger	268..288	CDD:275368	10/19 (53%)
		zf-H2C2_2	280..303	CDD:290200	8/23 (35%)
		C2H2 Zn finger	296..316	CDD:275368	3/7 (43%)
		zf-C2H2	322..344	CDD:278523
		C2H2 Zn finger	324..344	CDD:275368
		zf-H2C2_2	336..361	CDD:290200
		C2H2 Zn finger	352..372	CDD:275368
drm	NP_001285590.1	C2H2 Zn finger	28..48	CDD:275368	14/19 (74%)
drm	NP_001285590.1	C2H2 Zn finger	57..77	CDD:275368	10/19 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45444251
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000748
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	3	2.840