DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bowl and odd

DIOPT Version :9

Sequence 1:NP_001245861.1 Gene:bowl / 33602 FlyBaseID:FBgn0004893 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster


Alignment Length:352 Identity:142/352 - (40%)
Similarity:170/352 - (48%) Gaps:121/352 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 YETQLAYQQHLAGLH---GPPPPPPPSHHREISAFVPVLPTGKVRP---GSNSNYEIIAMMADKR 138
            |:.|...|||....|   .|..|.|..||              |||   |.:|.:          
  Fly   141 YQQQQQQQQHPHHHHHHGHPHHPHPHPHH--------------VRPYPAGLHSLH---------- 181

  Fly   139 KELALREAAAAAAMLGRGPGGPGGPGVPPPGVLYGPAGVPPPPYLTGPGPSPTGAGSFPFPPGAA 203
                       ||::||..|.       .|.:..|.||                 |:...|.||.
  Fly   182 -----------AAVMGRHFGA-------MPTLKLGGAG-----------------GASGVPSGAT 211

  Fly   204 AAALFPPGLGPGMHAGLDRRLLRAPGRASRPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSC 268
            .                          :||||||||||:||||||||||||||||||||||||||
  Fly   212 G--------------------------SSRPKKQFICKYCNRQFTKSYNLLIHERTHTDERPYSC 250

  Fly   269 DICGKAFRRQDHLRDHRYIHSKEKPFKCTECGKGFCQSRTLAVHKILHMEESPHKCPVCSRSFNQ 333
            ||||||||||||||||||||||:|||||::|||||||||||||||:.|:||.|||||:|.|||||
  Fly   251 DICGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKCPICQRSFNQ 315

  Fly   334 RSNLKTHLLTHTDHKPYECSSCGKVFRRNCDLRRHALTHAVGEVNSGDYVDVGEEDEARNLSGDE 398
            |:|||:||.:|::....|.          ......|.:|:|..               :.||..:
  Fly   316 RANLKSHLQSHSEQSTKEV----------VVTTSPATSHSVPN---------------QALSSPQ 355

  Fly   399 EDSLLEVDSPRQSPVHNLGESGGSGEK 425
            .::|.:     ..||.:|..|..|.||
  Fly   356 PENLAQ-----HLPVLDLSSSSSSSEK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bowlNP_001245861.1 COG5048 <232..372 CDD:227381 101/139 (73%)
C2H2 Zn finger 240..260 CDD:275368 18/19 (95%)
zf-H2C2_2 252..277 CDD:290200 24/24 (100%)
C2H2 Zn finger 268..288 CDD:275368 19/19 (100%)
zf-H2C2_2 280..303 CDD:290200 19/22 (86%)
C2H2 Zn finger 296..316 CDD:275368 16/19 (84%)
zf-C2H2 322..344 CDD:278523 16/21 (76%)
C2H2 Zn finger 324..344 CDD:275368 14/19 (74%)
zf-H2C2_2 336..361 CDD:290200 7/24 (29%)
C2H2 Zn finger 352..372 CDD:275368 1/19 (5%)
oddNP_722922.1 COG5048 <203..334 CDD:227381 102/156 (65%)
C2H2 Zn finger 222..242 CDD:275368 18/19 (95%)
zf-H2C2_2 234..259 CDD:290200 24/24 (100%)
C2H2 Zn finger 250..270 CDD:275368 19/19 (100%)
zf-H2C2_2 262..285 CDD:290200 19/22 (86%)
C2H2 Zn finger 278..298 CDD:275368 16/19 (84%)
zf-C2H2 304..326 CDD:278523 16/21 (76%)
C2H2 Zn finger 306..326 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11342
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D18266at7147
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 1 1.000 - - mtm6437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR14196
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
77.050

Return to query results.
Submit another query.