DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment bowl and Klf15

DIOPT Version :9

Sequence 1:	NP_001245861.1	Gene:	bowl / 33602	FlyBaseID:	FBgn0004893	Length:	744	Species:	Drosophila melanogaster
Sequence 2:	NP_572185.1	Gene:	Klf15 / 31410	FlyBaseID:	FBgn0025679	Length:	311	Species:	Drosophila melanogaster

Alignment Length:	144	Identity:	45/144 - (31%)
Similarity:	64/144 - (44%)	Gaps:	23/144 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   183 LTGPGPS----PTGAGSFPFPPGAA--AAALFPPGLGPGMHAGLDRRLLRAPGRASRPKKQFICK 241
            |:||..|    |..:.|.|....:|  |.|:.||.            .|:....|: .::.::|.
  Fly   149 LSGPPHSEIFVPDRSSSSPGSSDSASPAEAVAPPS------------ALQMSENAA-GERGYLCT 200

  Fly   242 F--CNRQFTKSYNLLIHERTHTDERPYSCD--ICGKAFRRQDHLRDHRYIHSKEKPFKCTECGKG 302
            |  |.:.:.|..:|..|.|.|..|:||.|.  .|...|.|.|.|..|:..||..||:||..|.|.
  Fly   201 FGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKC 265

  Fly   303 FCQSRTLAVHKILH 316
            |.:|..|..|:.:|
  Fly   266 FARSDHLTKHRKVH 279

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
bowl	NP_001245861.1	COG5048	<232..372	CDD:227381	31/89 (35%)
		C2H2 Zn finger	240..260	CDD:275368	7/21 (33%)
		zf-H2C2_2	252..277	CDD:290200	10/26 (38%)
		C2H2 Zn finger	268..288	CDD:275368	7/21 (33%)
		zf-H2C2_2	280..303	CDD:290200	10/22 (45%)
		C2H2 Zn finger	296..316	CDD:275368	7/19 (37%)
		zf-C2H2	322..344	CDD:278523
		C2H2 Zn finger	324..344	CDD:275368
		zf-H2C2_2	336..361	CDD:290200
		C2H2 Zn finger	352..372	CDD:275368
Klf15	NP_572185.1	zf-C2H2_8	199..278	CDD:292531	30/78 (38%)
		C2H2 Zn finger	203..221	CDD:275368	5/17 (29%)
		C2H2 Zn finger	229..251	CDD:275368	7/21 (33%)
		zf-H2C2_2	243..268	CDD:290200	11/24 (46%)
		C2H2 Zn finger	259..279	CDD:275368	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R2698
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.030