DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment bowl and prz1

DIOPT Version :9

Sequence 1:	NP_001245861.1	Gene:	bowl / 33602	FlyBaseID:	FBgn0004893	Length:	744	Species:	Drosophila melanogaster
Sequence 2:	NP_593073.1	Gene:	prz1 / 2541806	PomBaseID:	SPAC4G8.13c	Length:	681	Species:	Schizosaccharomyces pombe

Alignment Length:	108	Identity:	38/108 - (35%)
Similarity:	56/108 - (51%)	Gaps:	14/108 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   232 SRPKKQFICKF--CNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKEKPF 294
            |:.:..::|.|  ||::||::|||..|..|||:.||:.|.||.|:|.||...|.|..:|:..|.|
pombe   564 SKSQGNYVCTFAGCNKRFTRAYNLKSHMNTHTNYRPFQCSICKKSFARQHDKRRHEQLHTGIKAF 628

  Fly   295 KCTECGKGFCQSRTLAVHKILHMEESPHKCPV---CSRSFNQR 334
            .|..|.:.|.:...|..|         :|..|   |.|:..:|
pombe   629 ACVTCNQRFARMDALNRH---------YKSEVGQNCLRTATER 662

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
bowl	NP_001245861.1	COG5048	<232..372	CDD:227381	38/108 (35%)
		C2H2 Zn finger	240..260	CDD:275368	10/21 (48%)
		zf-H2C2_2	252..277	CDD:290200	13/24 (54%)
		C2H2 Zn finger	268..288	CDD:275368	9/19 (47%)
		zf-H2C2_2	280..303	CDD:290200	7/22 (32%)
		C2H2 Zn finger	296..316	CDD:275368	5/19 (26%)
		zf-C2H2	322..344	CDD:278523	5/16 (31%)
		C2H2 Zn finger	324..344	CDD:275368	4/14 (29%)
		zf-H2C2_2	336..361	CDD:290200
		C2H2 Zn finger	352..372	CDD:275368
prz1	NP_593073.1	COG5048	121..620	CDD:227381	25/55 (45%)
		zf-C2H2	570..594	CDD:278523	10/23 (43%)
		C2H2 Zn finger	577..594	CDD:275368	8/16 (50%)
		zf-H2C2_2	586..611	CDD:290200	13/24 (54%)
		C2H2 Zn finger	602..622	CDD:275368	9/19 (47%)
		zf-H2C2_2	616..639	CDD:290200	8/22 (36%)
		C2H2 Zn finger	630..648	CDD:275368	5/26 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R2698
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030