| Sequence 1: | NP_001245861.1 | Gene: | bowl / 33602 | FlyBaseID: | FBgn0004893 | Length: | 744 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005273482.1 | Gene: | EGR3 / 1960 | HGNCID: | 3240 | Length: | 442 | Species: | Homo sapiens |
| Alignment Length: | 464 | Identity: | 108/464 - (23%) |
|---|---|---|---|
| Similarity: | 153/464 - (32%) | Gaps: | 185/464 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 36 AAAAVGGGGLP-----------GAADRNGGS-------GGSDGGSQNG----------------- 65
Fly 66 ------NGDSRNSSASRISA--YETQLAYQQHLA---------GLHGPPPPPPPSHHREISAFVP 113
Fly 114 ------VLPTGKVRPGSNSNY---EIIAMMADKRKELALREAAAAAAMLGRGPGG---------- 159
Fly 160 -----PGG------PGVPP----------PGVLYGPAGVP-----PPPYLTGPGPS--------- 189
Fly 190 --------PTGAGSFP-FPP--GAAAAALFPPGLGP--GMHAGLDRRLLRAPGRASRPKKQFIC- 240
Fly 241 -----KFCNRQFTKSYNLLIHERTHTDERPYSC--DICGKAFRRQDHLRDHRYIHSKEKPFKCTE 298
Fly 299 CGKGFCQSRTLAVHKILHMEESPHKCPVCSRSFNQRSNLKTHLLTHTDHKPYECSSCGKVFRRNC 363
Fly 364 DLRRHALTH 372 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| bowl | NP_001245861.1 | COG5048 | <232..372 | CDD:227381 | 42/147 (29%) |
| C2H2 Zn finger | 240..260 | CDD:275368 | 3/25 (12%) | ||
| zf-H2C2_2 | 252..277 | CDD:290200 | 7/26 (27%) | ||
| C2H2 Zn finger | 268..288 | CDD:275368 | 7/21 (33%) | ||
| zf-H2C2_2 | 280..303 | CDD:290200 | 8/22 (36%) | ||
| C2H2 Zn finger | 296..316 | CDD:275368 | 1/19 (5%) | ||
| zf-C2H2 | 322..344 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 324..344 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 336..361 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 352..372 | CDD:275368 | 8/19 (42%) | ||
| EGR3 | XP_005273482.1 | DUF3446 | 142..202 | CDD:288757 | 16/73 (22%) |
| COG5048 | 324..>388 | CDD:227381 | 27/91 (30%) | ||
| zf-C2H2 | 330..354 | CDD:278523 | 7/23 (30%) | ||
| C2H2 Zn finger | 332..354 | CDD:275368 | 7/21 (33%) | ||
| zf-H2C2_2 | 346..371 | CDD:290200 | 12/52 (23%) | ||
| COG5048 | 358..>431 | CDD:227381 | 25/81 (31%) | ||
| C2H2 Zn finger | 362..382 | CDD:275368 | 8/47 (17%) | ||
| zf-H2C2_2 | 374..399 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 390..410 | CDD:275368 | 8/19 (42%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2698 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.940 | |||||