DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bowl and EGR1

DIOPT Version :9

Sequence 1:NP_001245861.1 Gene:bowl / 33602 FlyBaseID:FBgn0004893 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_001955.1 Gene:EGR1 / 1958 HGNCID:3238 Length:543 Species:Homo sapiens


Alignment Length:432 Identity:96/432 - (22%)
Similarity:146/432 - (33%) Gaps:131/432 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RMDQFMNSMAAAAAAVGGGGLPGAADRNGGSGGSDGGSQNGNGDSRNSSASRISAY-ETQLAYQQ 88
            ::::.|.....|...:|..|.|..:..|..|..|.||...|.|.:.:||:|..:.. :|.....:
Human    34 KLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYE 98

  Fly    89 HLA-------GLHGPPPPPPPSHHREISAFVPVLPTGK--VRPGSNSNYE------------IIA 132
            ||.       .|:........|:..:.:...|:..||:  :.|..||...            :::
Human    99 HLTAESFPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVS 163

  Fly   133 MMADKRKELALREAAAAAAMLGRGP----------GGP---GGPGVPPPG----------VLYGP 174
            |........:....||::|...:.|          ..|   ..|..|.|.          ...|.
Human   164 MTNPPASSSSAPSPAASSASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGS 228

  Fly   175 AGV----PPPPYLTGPGPSPTGAGSFPFPPGAAAAALFPP-----GLG----------------P 214
            ||.    |||.|       |...|.|..|  .....|||.     |||                |
Human   229 AGTALQYPPPAY-------PAAKGGFQVP--MIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQP 284

  Fly   215 GM------------HAGLDRRLLRAPGRASRPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYS 267
            .:            ....|.:.|....::...|...:.|:.||.          .:|...||||:
Human   285 SLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRP----------SKTPPHERPYA 339

  Fly   268 CDI--CGKAFRRQDHLRDHRYIHSKEKPFKCTECGKGFCQSRTLAVHKILHMEESPHKCPVCSRS 330
            |.:  |.:.|.|.|.|..|..||:.:|||:|.                            :|.|:
Human   340 CPVESCDRRFSRSDELTRHIRIHTGQKPFQCR----------------------------ICMRN 376

  Fly   331 FNQRSNLKTHLLTHTDHKPYECSSCGKVFRRNCDLRRHALTH 372
            |::..:|.||:.|||..||:.|..||:.|.|:.:.:||...|
Human   377 FSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIH 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bowlNP_001245861.1 COG5048 <232..372 CDD:227381 40/141 (28%)
C2H2 Zn finger 240..260 CDD:275368 3/19 (16%)
zf-H2C2_2 252..277 CDD:290200 8/26 (31%)
C2H2 Zn finger 268..288 CDD:275368 7/21 (33%)
zf-H2C2_2 280..303 CDD:290200 8/22 (36%)
C2H2 Zn finger 296..316 CDD:275368 1/19 (5%)
zf-C2H2 322..344 CDD:278523 6/21 (29%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
zf-H2C2_2 336..361 CDD:290200 12/24 (50%)
C2H2 Zn finger 352..372 CDD:275368 7/19 (37%)
EGR1NP_001955.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..105 18/70 (26%)
DUF3446 135..209 CDD:314753 11/73 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..213 7/47 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..284 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..339 7/30 (23%)
zf-C2H2 338..362 CDD:306579 8/23 (35%)
C2H2 Zn finger 340..362 CDD:275368 7/21 (33%)
zf-H2C2_2 354..379 CDD:316026 11/52 (21%)
C2H2 Zn finger 370..390 CDD:275368 7/47 (15%)
zf-H2C2_2 382..407 CDD:316026 12/24 (50%)
C2H2 Zn finger 398..418 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 409..487 3/10 (30%)
DUF3432 447..530 CDD:288743
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.