DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bowl and odd-1

DIOPT Version :9

Sequence 1:NP_001245861.1 Gene:bowl / 33602 FlyBaseID:FBgn0004893 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_498552.2 Gene:odd-1 / 181893 WormBaseID:WBGene00003845 Length:242 Species:Caenorhabditis elegans


Alignment Length:148 Identity:74/148 - (50%)
Similarity:92/148 - (62%) Gaps:20/148 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 PSPTGAGSFPFPPGAA---------AAALF-----PPGLGPGMHAGLDRRLLRAPGRASRPKKQF 238
            |:|:.|.:...|....         .:.||     |..|.|..|...:..:.:      ||||:|
 Worm    70 PTPSNASTSTIPAQMTNENVLHLQIQSQLFSNLGTPWFLNPEQHNKTNNAIRK------RPKKEF 128

  Fly   239 ICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKEKPFKCTECGKGF 303
            |||:|.|.|||||||:|||||||:|||:.|:.|||:||||||||||:|||:||||.||..|||||
 Worm   129 ICKYCARHFTKSYNLMIHERTHTNERPFHCETCGKSFRRQDHLRDHKYIHAKEKPHKCEICGKGF 193

  Fly   304 CQSRTLAVHKILHMEESP 321
            ||.|||.||:..|..:.|
 Worm   194 CQLRTLNVHRSCHHVQEP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bowlNP_001245861.1 COG5048 <232..372 CDD:227381 64/90 (71%)
C2H2 Zn finger 240..260 CDD:275368 15/19 (79%)
zf-H2C2_2 252..277 CDD:290200 17/24 (71%)
C2H2 Zn finger 268..288 CDD:275368 15/19 (79%)
zf-H2C2_2 280..303 CDD:290200 17/22 (77%)
C2H2 Zn finger 296..316 CDD:275368 13/19 (68%)
zf-C2H2 322..344 CDD:278523 74/148 (50%)
C2H2 Zn finger 324..344 CDD:275368
zf-H2C2_2 336..361 CDD:290200
C2H2 Zn finger 352..372 CDD:275368
odd-1NP_498552.2 C2H2 Zn finger 130..150 CDD:275368 15/19 (79%)
zf-H2C2_2 142..167 CDD:290200 17/24 (71%)
C2H2 Zn finger 158..178 CDD:275368 15/19 (79%)
zf-H2C2_2 170..193 CDD:290200 17/22 (77%)
C2H2 Zn finger 186..206 CDD:275368 13/19 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I7667
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 1 1.000 - - mtm4817
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14196
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.