DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bowl and OSR1

DIOPT Version :9

Sequence 1:NP_001245861.1 Gene:bowl / 33602 FlyBaseID:FBgn0004893 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_660303.1 Gene:OSR1 / 130497 HGNCID:8111 Length:266 Species:Homo sapiens


Alignment Length:289 Identity:120/289 - (41%)
Similarity:139/289 - (48%) Gaps:86/289 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 QLAYQQHLAGLHGPPPPPP------------------------PSHHREISAFVPVLPTGKVRPG 123
            ||.....|..::|.|..|.                        |:.|...|:|..|       ||
Human    17 QLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKV-------PG 74

  Fly   124 SNSNYEIIAMMADKRKELALREAAAAAAMLGRGPGGPGGPGVPPPGVLYGPAGVPPPPYLTGPG- 187
            :      ::.:.|.|.:|               |..|..|.|           :.|.|.:|..| 
Human    75 T------VSSLVDARFQL---------------PAFPWFPHV-----------IQPKPEITAGGS 107

  Fly   188 -PSPTGAGSFPFPPGAAAAALFPP-----GLGPGMHAG-----LDRRLL---RAPGRA---SRPK 235
             |:......|.|...|.||....|     |.|||..||     ||...|   :.|.|.   |:.|
Human   108 VPALKTKPRFDFANLALAATQEDPAKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTK 172

  Fly   236 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKEKPFKCTECG 300
            |:|:||||.|.||||||||||||||||||||:||||.||||||||||||||||||||||||.|||
Human   173 KEFVCKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECG 237

  Fly   301 KGFCQSRTLAVHKILH-----MEESPHKC 324
            |||||||||||||.||     ::.|..||
Human   238 KGFCQSRTLAVHKTLHSQVKELKTSKIKC 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bowlNP_001245861.1 COG5048 <232..372 CDD:227381 78/98 (80%)
C2H2 Zn finger 240..260 CDD:275368 17/19 (89%)
zf-H2C2_2 252..277 CDD:290200 22/24 (92%)
C2H2 Zn finger 268..288 CDD:275368 18/19 (95%)
zf-H2C2_2 280..303 CDD:290200 21/22 (95%)
C2H2 Zn finger 296..316 CDD:275368 17/19 (89%)
zf-C2H2 322..344 CDD:278523 2/3 (67%)
C2H2 Zn finger 324..344 CDD:275368 1/1 (100%)
zf-H2C2_2 336..361 CDD:290200
C2H2 Zn finger 352..372 CDD:275368
OSR1NP_660303.1 zf-C2H2 175..197 CDD:306579 18/21 (86%)
C2H2 Zn finger 177..197 CDD:275368 17/19 (89%)
zf-H2C2_2 189..214 CDD:316026 22/24 (92%)
C2H2 Zn finger 205..225 CDD:275368 18/19 (95%)
zf-H2C2_2 217..240 CDD:316026 21/22 (95%)
C2H2 Zn finger 233..253 CDD:275368 17/19 (89%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11341
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 1 1.000 - - mtm8449
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14196
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.