DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment bowl and klf15

DIOPT Version :9

Sequence 1:	NP_001245861.1	Gene:	bowl / 33602	FlyBaseID:	FBgn0004893	Length:	744	Species:	Drosophila melanogaster
Sequence 2:	XP_002938279.1	Gene:	klf15 / 100495857	XenbaseID:	XB-GENE-854149	Length:	394	Species:	Xenopus tropicalis

Alignment Length:	138	Identity:	50/138 - (36%)
Similarity:	67/138 - (48%)	Gaps:	16/138 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   200 PGAAAAALFPPGLGPGMHAG--LDRRLLRAPGRASRPKKQFICKF--CNRQFTKSYNLLIHERTH 260
            |...||....||.|....||  :.::..:.|  |:...|...|.|  |.:.:|||.:|..|.|.|
Frog   261 PVPIAAKPVGPGGGIQGQAGVMIGQKFQKNP--ATELIKMHKCTFPGCTKMYTKSSHLKAHLRRH 323

  Fly   261 TDERPYSCDI--CGKAFRRQDHLRDHRYIHSKEKPFKCTECGKGFCQSRTLAVH-KILHMEESPH 322
            |.|:|::|..  ||..|.|.|.|..||..||..||::|..|.|.|.:|..|:.| |:       |
Frog   324 TGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCAVCEKKFARSDHLSKHIKV-------H 381

  Fly   323 KCPVCSRS 330
            :.|..|||
Frog   382 RFPRSSRS 389

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
bowl	NP_001245861.1	COG5048	<232..372	CDD:227381	40/104 (38%)
		C2H2 Zn finger	240..260	CDD:275368	9/21 (43%)
		zf-H2C2_2	252..277	CDD:290200	11/26 (42%)
		C2H2 Zn finger	268..288	CDD:275368	9/21 (43%)
		zf-H2C2_2	280..303	CDD:290200	10/22 (45%)
		C2H2 Zn finger	296..316	CDD:275368	8/20 (40%)
		zf-C2H2	322..344	CDD:278523	5/9 (56%)
		C2H2 Zn finger	324..344	CDD:275368	4/7 (57%)
		zf-H2C2_2	336..361	CDD:290200
		C2H2 Zn finger	352..372	CDD:275368
klf15	XP_002938279.1	SFP1	<284..379	CDD:227516	36/96 (38%)
		C2H2 Zn finger	301..323	CDD:275368	9/21 (43%)
		C2H2 Zn finger	331..353	CDD:275368	9/21 (43%)
		zf-H2C2_2	345..370	CDD:372612	11/24 (46%)
		C2H2 Zn finger	361..381	CDD:275368	8/26 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R2698
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030