DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10019 and chk

DIOPT Version :9

Sequence 1:NP_001368939.1 Gene:CG10019 / 33600 FlyBaseID:FBgn0031568 Length:1159 Species:Drosophila melanogaster
Sequence 2:NP_001163063.1 Gene:chk / 35578 FlyBaseID:FBgn0033095 Length:894 Species:Drosophila melanogaster


Alignment Length:428 Identity:94/428 - (21%)
Similarity:176/428 - (41%) Gaps:81/428 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 HHQQRAKNLMANGGCYFGYEANHHPSLHATTPHPS----HITDEEDSAFP----------GLADR 411
            ::....:|...|||      |:::.:| ..||.|:    |...:.| .||          .|||.
  Fly    20 NNNHNGQNQSQNGG------ASNYQAL-PLTPAPANTPLHKAIKHD-LFPEVTFCNLSVEELADG 76

  Fly   412 EFH------------------LLHRNIPALRR---------TGVD--TTRIRQYFYPDGGWGWII 447
            ..|                  |::.|....||         ..:|  :|..:....||||:||::
  Fly    77 AGHSRVVRSSVIELEDGTMTCLMNGNGQVKRRKRLISNESGDSIDSSSTEKKTPKMPDGGYGWVV 141

  Fly   448 CGVSFLVHILTTGLQLSYGLLWFYAVQYL-HNTSGIELLGALSWSVSMVATSFVVSLCRKRSIRL 511
            ...|.:|.::..||..|:||:....::|. .:||....:.:|.:||.::......:|..|...|.
  Fly   142 VFASLVVSLIADGLSFSFGLINVELLEYFGESTSKTAWISSLFFSVPLLMGPIWSNLVDKYGCRK 206

  Fly   512 LSIVGGLVMPLGILFTSFATEFGQVVFSYGIVFGVGVAMVREASTVMLGNYFKRRRQFVEMVAMS 576
            ::|:||:|...|...:||......::.::||:.|:|:.:....:.|.:..:|.::|.|...:..|
  Fly   207 MTILGGVVSAFGFALSSFCNSIEMLMVTFGIISGLGLGIGYVTAVVSIAFWFDKKRTFATGIGAS 271

  Fly   577 GEGVGIALFSVILKEGVGKAGWRLGLQIVAALTALSFFM--GLMYRPASLYHPQR-----RAIQH 634
            |.|:|..:::.:....:...||| |..::...|.|:..:  .||..|..|....|     :::..
  Fly   272 GTGIGTFVYARLTSYLIESYGWR-GATLILGGTMLNACVCGALMRDPDWLIEENRLESRSQSVTT 335

  Fly   635 LKNQRKKMREKKPILSQDVESTPKYFFLDISSLKSVTVKILLMTSSVASFGIYTPMFLMALNAAE 699
            ..|....:.|.|.:|...:            :.::|...::...::.|:..|..|     |::|.
  Fly   336 FSNSSVCLEEIKKLLDTGI------------TKEAVLDSLVTKNNTEANQQIDDP-----LDSAL 383

  Fly   700 QGSDVQELVLLQTFLGISMALGVVIAGALLRRCFVIRH 737
            :  ..:..:.|.|||.......:....:|.||.  :||
  Fly   384 K--RYRSEIFLPTFLSTQELDSICEVKSLSRRS--LRH 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10019NP_001368939.1 MFS_MCT_SLC16 444..840 CDD:340910 67/302 (22%)
chkNP_001163063.1 MFS 143..>315 CDD:119392 42/172 (24%)
MFS <685..869 CDD:119392
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.