DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10019 and out

DIOPT Version :9

Sequence 1:NP_001368939.1 Gene:CG10019 / 33600 FlyBaseID:FBgn0031568 Length:1159 Species:Drosophila melanogaster
Sequence 2:NP_001285435.1 Gene:out / 32926 FlyBaseID:FBgn0259834 Length:655 Species:Drosophila melanogaster


Alignment Length:239 Identity:54/239 - (22%)
Similarity:106/239 - (44%) Gaps:28/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 DTTRIRQ------------YFYPDGGWGWIICGVSFLVHILTTGLQLSYGLLWFYAVQYL----- 476
            |||:.::            :..|||||||::|..:.|.:.........|||::...:|.|     
  Fly    17 DTTKPKKPKRRDKSDLGPDFVAPDGGWGWVVCLAAGLNNFFLFPALQQYGLIYRVRMQSLGFDAK 81

  Fly   477 HNTSGIELLGALSWSVSMVATSFVVSLCRKRSIRLLSIVGGLVMPLGILFTSFATEFGQVVFSYG 541
            ..|:.:.::.|:|..|.:|..    ::.|:.:.|.:::.|..:..||:..::|.|.|.|.:....
  Fly    82 QTTTIVNVVMAISSLVGIVNG----AMFRRFTFRQVALTGTSLAFLGVFLSAFCTTFWQYIICLS 142

  Fly   542 IVFGVGVAMVREASTVMLGNYFKRRRQFVEMVAMSGEGVGIALFSVILKEGVGKAGWRLGLQIVA 606
            .:||:|:.:...|:::.:..|||.:|:.....:.:..|:|...|..:....:|..|.:..:.|.|
  Fly   143 AIFGIGLGLAMAATSLAVNTYFKLKRRRATGFSWTITGLGPIFFPQVSTVLLGYYGAQGTILIYA 207

  Fly   607 ALTALSFFMGLMYRPASLYH------PQRRAIQHLKNQRKKMRE 644
            .:...:....|..:|. |:|      |....|:.:....|...|
  Fly   208 GIAMNAILCALTLQPV-LWHVKKPEKPVHNTIEGIAETEKLQPE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10019NP_001368939.1 MFS_MCT_SLC16 444..840 CDD:340910 46/212 (22%)
outNP_001285435.1 MFS 45..>225 CDD:119392 39/184 (21%)
MFS <464..621 CDD:119392
MFS_1 468..>621 CDD:284993
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.