DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10019 and CG8034

DIOPT Version :9

Sequence 1:NP_001368939.1 Gene:CG10019 / 33600 FlyBaseID:FBgn0031568 Length:1159 Species:Drosophila melanogaster
Sequence 2:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster


Alignment Length:176 Identity:55/176 - (31%)
Similarity:94/176 - (53%) Gaps:25/176 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 PDGGWGWIIC-GVSFLVHILTTGLQLSYGLLWFYAVQYLH--NTSGIELLGALSWSVSMVATSFV 500
            |||||||:.| ||| ||::.|..::.|:|||:...::.|:  .|....::.||...::. :..||
  Fly    11 PDGGWGWVACFGVS-LVNLATRSIEPSFGLLFGDTLKELNVGTTGAAVIISALDVCMNF-SGLFV 73

  Fly   501 VSLCRKRSIRLLSIVGGLVMPLGILFTSFATEFGQVVFSYGIVFGVGVAMVREASTVMLGNYFKR 565
            ..|.::.|.|.::|.|.|:..||:..||.||....::.:|.::.|:||.:...|:.|.|.:|||.
  Fly    74 GPLLKEFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVINGIGVGLSTSAAFVALNHYFKH 138

  Fly   566 RRQFVEMVAMSGEGVGIALFSVILKEGVGKAGWRLGLQIVAALTAL 611
            :|         |:.||:::           ||..:|:.|:..|..:
  Fly   139 KR---------GQAVGLSM-----------AGTAMGMLIMPQLVRI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10019NP_001368939.1 MFS_MCT_SLC16 444..840 CDD:340910 50/171 (29%)
CG8034NP_573376.2 MFS 20..>197 CDD:119392 48/167 (29%)
MFS <437..583 CDD:119392
MFS_1 437..>581 CDD:284993
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.