DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10019 and gem-1

DIOPT Version :9

Sequence 1:NP_001368939.1 Gene:CG10019 / 33600 FlyBaseID:FBgn0031568 Length:1159 Species:Drosophila melanogaster
Sequence 2:NP_001379120.1 Gene:gem-1 / 181458 WormBaseID:WBGene00008214 Length:771 Species:Caenorhabditis elegans


Alignment Length:273 Identity:60/273 - (21%)
Similarity:111/273 - (40%) Gaps:69/273 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 HHQQRAKNLMANGGCYFGYEANHHPSLHATTPHP-SHITDEEDSAFPGLADREFHLLHRNIPALR 424
            |:||             .:..:..|.:....|.| |..:|:.|:              .::.:|.
 Worm    24 HNQQ-------------PFSPSDEPRVRFEAPAPVSARSDDSDA--------------ESVESLT 61

  Fly   425 RTGVDTTRIRQYFYPDGGWGWIICGVSFLVHILTTGLQLSYGLLWFYAVQYLHNTSGIELLGALS 489
            ...|         |.|||:||::...|||:|.:..|....:|:: |..:|. |...|        
 Worm    62 ERPV---------YKDGGYGWLVVLASFLMHAVCDGASFCFGIV-FVKIQE-HFQCG-------- 107

  Fly   490 WSVSMVATSFVVSL----------------CRKRSIRLLSIVGGLVMPLGILFTSFATEFGQVVF 538
            ..|||:..|..:||                |     |:..|:|..:..:..:...|.:.....:.
 Worm   108 RFVSMITASMFLSLPLIMSPVAGIVSDILGC-----RMSIIIGASICTVSCIIAMFCSHIFFFMI 167

  Fly   539 SYGIVFGVGVAMVREASTVMLGNYFKRRRQFVEMVAMSGEGVGIALFSVILK-EGVGKAGWRLGL 602
            |:|:..|||::.:..|:.|::..||::||......|:||.|||..::.::|. ..:..|.:...:
 Worm   168 SFGLGCGVGMSFIYNAAIVIVTYYFEKRRGLATSFAVSGTGVGTVIYPILLNLSMIYLASFVSDI 232

  Fly   603 QIVAALTALSFFM 615
            :|:....|:.:|:
 Worm   233 RIILIFFAVMYFV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10019NP_001368939.1 MFS_MCT_SLC16 444..840 CDD:340910 45/189 (24%)
gem-1NP_001379120.1 MFS 72..>254 CDD:421695 45/189 (24%)
MFS <543..727 CDD:421695
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.