DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and KCO5

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_192093.1 Gene:KCO5 / 828091 AraportID:AT4G01840 Length:408 Species:Arabidopsis thaliana


Alignment Length:225 Identity:52/225 - (23%)
Similarity:94/225 - (41%) Gaps:57/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 SSVNIIDYIATLSFYIDLVLQRFASH---LE----------NADILEFFSIIRIMRLFKLTRHSS 328
            :|:.|...|:..||:.::..:|...|   ||          ::|..|....:...|....:|.:.
plant    27 ASITIPRSISNTSFFHEISQERLLLHHQDLEQSVQDDKEDQDSDSDETNRFLSQTRPLHRSRTAP 91

  Fly   329 GLKILIQTFRASAKE---------------LTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNS 378
            .: ::|:..|....|               :.||:.:|.||:.|::....:...|:.:|..|   
plant    92 AM-VIIKDLRTKPPETKKPSPVSKSIIRQAIFLLIVYLTLGVSIYSFNRDHYSGIETHPVVD--- 152

  Fly   379 IPLGLWWALVTMTTVGYGDMAP-----KTYIGMFV----GAL-CALAGVLTIALPV--PVIVSNF 431
               .|::.:|||.|:||||:||     |.:..:||    |.| ..|:||:...|.:  .:|::..
plant   153 ---ALYFCIVTMCTIGYGDIAPLTPWTKIFAVVFVLFGFGFLDILLSGVVNYVLDLQESMILTGI 214

  Fly   432 A-----MYYSHTQARAK-----LPKKRRRV 451
            .     .::.|.:..||     ..|.|.|:
plant   215 QTRQHHQHHHHHRFSAKDYIIDFEKGRMRI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 47/206 (23%)
Ion_trans_2 355..429 CDD:285168 25/85 (29%)
KCO5NP_192093.1 Ion_trans_2 122..204 CDD:285168 28/87 (32%)
Ion_trans_2 254..325 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.