DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Shaw and ZBTB8A

DIOPT Version :9

Sequence 1:	NP_001137782.1	Gene:	Shaw / 33599	FlyBaseID:	FBgn0003386	Length:	619	Species:	Drosophila melanogaster
Sequence 2:	NP_001035531.2	Gene:	ZBTB8A / 653121	HGNCID:	24172	Length:	441	Species:	Homo sapiens

Alignment Length:	114	Identity:	25/114 - (21%)
Similarity:	37/114 - (32%)	Gaps:	36/114 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly    74 PGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRL 138
            |..|..:|::..:|||    .:.|             .|.:|.....::.|..|.........:.
Human    73 PDTFTVILDFVYSGKL----SLTG-------------QNVIEVMSAASFLQMTDVISVCKTFIKS 120

  Fly   139 DLDTEKPSEEELARKFGFEE-----------DYYKGTISWWQE--MKPR 174
            .||.   ||:|..|.|...:           .:|.|   .|||  ..||
Human   121 SLDI---SEKEKDRYFSLSDKDANSNGVERSSFYSG---GWQEGSSSPR 163

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Shaw	NP_001137782.1	BTB	27..125	CDD:197585	9/50 (18%)
		BTB_2	27..117	CDD:280393	9/42 (21%)
		Ion_trans	244..439	CDD:278921
		Ion_trans_2	355..429	CDD:285168
ZBTB8A	NP_001035531.2	BTB	14..119	CDD:279045	11/62 (18%)
		BTB	25..122	CDD:197585	11/65 (17%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	143..251		7/24 (29%)
		COG5048	282..>335	CDD:227381
		C2H2 Zn finger	284..304	CDD:275368
		zf-H2C2_2	296..321	CDD:290200
		C2H2 Zn finger	312..331	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910