DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and KCTD16

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001357415.1 Gene:KCTD16 / 57528 HGNCID:29244 Length:428 Species:Homo sapiens


Alignment Length:324 Identity:62/324 - (19%)
Similarity:105/324 - (32%) Gaps:145/324 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDP---ILNE--------YFFDRHPGVFAQV 80
            |.|||||..:.|..:||..||.:.|.::      :.|   ..|:        :|.||...:|..:
Human    27 VELNVGGQVYFTRHSTLISIPHSLLWKM------FSPKRDTANDLAKDSKGRFFIDRDGFLFRYI 85

  Fly    81 LNYYRTGKL----HYPTDVCGPLFEEELEFWGL---------DSNQVEP---CCWMTYTQHRDTQ 129
            |:|.|..::    |:|..  |.| :.|.|::.|         |..:..|   |       |.|.:
Human    86 LDYLRDRQVVLPDHFPEK--GRL-KREAEYFQLPDLVKLLTPDEIKQSPDEFC-------HSDFE 140

  Fly   130 ETLAVLDRLDLDTEKPSEEELA---------RKFGFEEDYYKGTISWWQEMK--------PRIWS 177
                       |..:.|:..:.         ||:||....|:|:.:..:|.:        |||  
Human   141 -----------DASQGSDTRICPPSSLLPADRKWGFITVGYRGSCTLGREGQADAKFRRVPRI-- 192

  Fly   178 LFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQT-N 241
                                .:|             .|:.:.:.:..:|.|.|.    |..:. .
Human   193 --------------------LVC-------------GRISLAKEVFGETLNESR----DPDRAPE 220

  Fly   242 AHIAFFYI-------------EC-----VCNA---------------WFTFEILVRFISSPNKW 272
            .:.:.||:             ||     .||:               |.::...| |...|::|
Human   221 RYTSRFYLKFKHLERAFDMLSECGFHMVACNSSVTASFINQYTDDKIWSSYTEYV-FYREPSRW 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585 31/124 (25%)
BTB_2 27..117 CDD:280393 30/116 (26%)
Ion_trans 244..439 CDD:278921 11/62 (18%)
Ion_trans_2 355..429 CDD:285168
KCTD16NP_001357415.1 BTB_POZ_KCTD16 23..125 CDD:349706 28/106 (26%)
H1_KCTD16 160..280 CDD:409030 25/159 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.