DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and kcna7

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:XP_701294.4 Gene:kcna7 / 572481 ZFINID:ZDB-GENE-120215-257 Length:233 Species:Danio rerio


Alignment Length:200 Identity:60/200 - (30%)
Similarity:92/200 - (46%) Gaps:52/200 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRT-GKL 89
            |:.:||.|:|:||...||.:.|.:.|......|..:||:.||.|.||:...|..:|.:|:: |:|
Zfish    68 RLAINVSGMRYETQIRTLAQFPDSLLGDPRRRLRYFDPLRNEIFLDRNRFCFDAILYFYQSGGRL 132

  Fly    90 HYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKF 154
            ..|.:|...:|.:||.|:.|.                                     |::..:|
Zfish   133 RRPANVPLDVFMDELRFYELG-------------------------------------EDIMARF 160

  Fly   155 GFEEDYYKGTISWWQEMKP--------RIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTH 211
            ..:|.:.|      :|.:|        :||.||:.|.||..|:.|.::||..|.:|||.|||:|.
Zfish   161 KEDEGFPK------EEPRPLPESEFQRKIWMLFEHPESSGGARIIAIISVMVIVVSILIFCLETL 219

  Fly   212 PDMRV 216
            ||.||
Zfish   220 PDFRV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585 30/98 (31%)
BTB_2 27..117 CDD:280393 30/90 (33%)
Ion_trans 244..439 CDD:278921
Ion_trans_2 355..429 CDD:285168
kcna7XP_701294.4 BTB_2 71..160 CDD:280393 31/125 (25%)
BTB 71..158 CDD:197585 31/123 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.