Sequence 1: | NP_001137782.1 | Gene: | Shaw / 33599 | FlyBaseID: | FBgn0003386 | Length: | 619 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_701294.4 | Gene: | kcna7 / 572481 | ZFINID: | ZDB-GENE-120215-257 | Length: | 233 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 60/200 - (30%) |
---|---|---|---|
Similarity: | 92/200 - (46%) | Gaps: | 52/200 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 RVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRT-GKL 89
Fly 90 HYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKF 154
Fly 155 GFEEDYYKGTISWWQEMKP--------RIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTH 211
Fly 212 PDMRV 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Shaw | NP_001137782.1 | BTB | 27..125 | CDD:197585 | 30/98 (31%) |
BTB_2 | 27..117 | CDD:280393 | 30/90 (33%) | ||
Ion_trans | 244..439 | CDD:278921 | |||
Ion_trans_2 | 355..429 | CDD:285168 | |||
kcna7 | XP_701294.4 | BTB_2 | 71..160 | CDD:280393 | 31/125 (25%) |
BTB | 71..158 | CDD:197585 | 31/123 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2126 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |