DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Shaw and kcnk2a

DIOPT Version :9

Sequence 1:	NP_001137782.1	Gene:	Shaw / 33599	FlyBaseID:	FBgn0003386	Length:	619	Species:	Drosophila melanogaster
Sequence 2:	XP_021323122.1	Gene:	kcnk2a / 559728	ZFINID:	ZDB-GENE-061226-2	Length:	426	Species:	Danio rerio

Alignment Length:	137	Identity:	31/137 - (22%)
Similarity:	55/137 - (40%)	Gaps:	34/137 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   344 LTLLVFFLVLGIVIFA---SLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMA------ 399
            :|..|.|::.|.::|.   :|::        .|.:..|....:::.::|:||:|:||..
Zfish   221 VTSTVLFILFGCLLFVALPALIF--------QHIEGWSALESIYFVVITLTTIGFGDFVAGGSEI 277

  Fly   400 -------PKTYIGMFVGALCALAGVLT--------IALPVPVIVSNFAMYYSHTQARAKLP-KKR 448
                   |..:..:.|| |...|.||:        |:......|..|..:.:...|..... |:.
Zfish   278 EYLDYYKPIVWFWILVG-LAYFAAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVSAEFKET 341

  Fly   449 RRVLPVE 455
            ||.|.||
Zfish   342 RRRLSVE 348

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Shaw	NP_001137782.1	BTB	27..125	CDD:197585
		BTB_2	27..117	CDD:280393
		Ion_trans	244..439	CDD:278921	24/118 (20%)
		Ion_trans_2	355..429	CDD:285168	18/97 (19%)
kcnk2a	XP_021323122.1	Ion_trans_2	<140..194	CDD:311712
kcnk2a	XP_021323122.1	Ion_trans_2	232..310	CDD:311712	17/86 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X19
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.000