DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and KCTD9

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_060104.2 Gene:KCTD9 / 54793 HGNCID:22401 Length:389 Species:Homo sapiens


Alignment Length:91 Identity:30/91 - (32%)
Similarity:45/91 - (49%) Gaps:8/91 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VVLNVGGIRHETYKATL-KKIPATRLSRLTE---ALANYDPILNEYFFDRHPGVFAQVLNYYRTG 87
            :.|||||....|.::|| .|.|.:.|:.:.:   ...|.......:..||.|..|..:|||.|.|
Human    91 LTLNVGGRYFTTTRSTLVNKEPDSMLAHMFKDKGVWGNKQDHRGAFLIDRSPEYFEPILNYLRHG 155

  Fly    88 KL--HYPTDVCGPLFEEELEFWGLDS 111
            :|  :...::.|.|  ||..|:|:||
Human   156 QLIVNDGINLLGVL--EEARFFGIDS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585 30/91 (33%)
BTB_2 27..117 CDD:280393 30/91 (33%)
Ion_trans 244..439 CDD:278921
Ion_trans_2 355..429 CDD:285168
KCTD9NP_060104.2 KHA 2..66 CDD:340593
BTB_POZ_KCTD9 89..188 CDD:349677 30/91 (33%)
YjbI 168..378 CDD:224276 7/14 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.