DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and hpgd

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001007992.1 Gene:hpgd / 493354 XenbaseID:XB-GENE-942249 Length:264 Species:Xenopus tropicalis


Alignment Length:119 Identity:28/119 - (23%)
Similarity:43/119 - (36%) Gaps:26/119 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKMQHYAHAAMNLIN-------MDSENRVVLNVGGIRHETY---KATLKK--------IPATRLS 52
            |.::|:....: |:|       .|.|..:.:|:..:...||   :...||        |..:.|:
 Frog    77 KTVEHFGRLDI-LVNNAGVNNEKDWEKTIEVNLTSVIRGTYLGLELMSKKNGGHGGVIINISSLA 140

  Fly    53 RLTEALANYDPILNE-----YFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFE 101
            .||.|.  |.|:.:.     ..|.|.....|.:.||........|..|..||.|
 Frog   141 GLTPAA--YQPVYSASKHGVIGFTRSIAALASIGNYGVRINTVCPAFVDTPLLE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585 22/91 (24%)
BTB_2 27..117 CDD:280393 22/91 (24%)
Ion_trans 244..439 CDD:278921
Ion_trans_2 355..429 CDD:285168
hpgdNP_001007992.1 ADH_SDR_c_like 6..254 CDD:187584 28/119 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.