DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and Task6

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster


Alignment Length:328 Identity:61/328 - (18%)
Similarity:102/328 - (31%) Gaps:114/328 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 AVLDRLDLDTEK-------PSEEELARKFGFEEDYYK--GTISWWQEMKPRIWSLFDEPYSSNAA 188
            ||.|.|:.:|||       .:|:.:.||:...::.:|  .|:....|             |..|.
  Fly    24 AVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVLKSE-------------SHKAG 75

  Fly   189 KTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVC 253
            :.......|:...::|:.....|.          |..|..|.                  :..:|
  Fly    76 QQWKFTGAFYYATTVLTTIGYGHS----------TPSTVGGK------------------LFTMC 112

  Fly   254 NAWFTFEI-LVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRI 317
            .|.....: ||.|.|       |...||      .||.|:                         
  Fly   113 YAIVGIPLGLVMFQS-------IGERVN------RLSSYV------------------------- 139

  Fly   318 MRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLG 382
               .|..|.|...|      |..|.|:.|:.....|..:..|.......:.:...:  |:|:   
  Fly   140 ---IKAVRSSLRCK------RTVASEVDLICVVTTLSSLTIAGGAAAFSKFEGWSY--FDSV--- 190

  Fly   383 LWWALVTMTTVGYGDMAP---------KTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHT 438
             ::..:|:||:|:|||..         |....|| ..:..|.|:..:|..:.::|..|....:..
  Fly   191 -YYCFITLTTIGFGDMVALQRDNALNRKPEYVMF-ALIFILFGLAIVAASLNLLVLRFVTMNTED 253

  Fly   439 QAR 441
            :.|
  Fly   254 ERR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 39/204 (19%)
Ion_trans_2 355..429 CDD:285168 16/82 (20%)
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 13/89 (15%)
Ion_trans_2 169..247 CDD:285168 17/84 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
11.000

Return to query results.
Submit another query.