DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and KCNS3

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001269357.1 Gene:KCNS3 / 3790 HGNCID:6302 Length:491 Species:Homo sapiens


Alignment Length:428 Identity:139/428 - (32%)
Similarity:223/428 - (52%) Gaps:44/428 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ENRVVLNVGGIRHETYKATLKKIPATRLSRL---------TEALANYDPILNEYFFDRHPGVFAQ 79
            |..|.|||||.:....::||.:.|.|||.:|         .|...:|.....||:|||:|.:|..
Human    14 EELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDYSVADKEYYFDRNPSLFRY 78

  Fly    80 VLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRL--DLDT 142
            |||:|.|||||...::|...|.:|:|:||::...::.||...| |.|..:......|:.  |:.|
Human    79 VLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNRY-QERKEENHEKDWDQKSHDVST 142

  Fly   143 EKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFC 207
            :...||...    ||::..|.....:.:::.:||...:.|....:||.|.:.|:..:..||::.|
Human   143 DSSFEESSL----FEKELEKFDTLRFGQLRKKIWIRMENPAYCLSAKLIAISSLSVVLASIVAMC 203

  Fly   208 LKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKW 272
            :.:..:.:             ..:|...|.......||       |.||||.|:.||..::|.:.
Human   204 VHSMSEFQ-------------NEDGEVDDPVLEGVEIA-------CIAWFTGELAVRLAAAPCQK 248

  Fly   273 EFIKSSVNIIDYIATLSFYIDLVL---QRFASHLEN-ADILEFFSIIRIMRLFKLTRHSSGLKIL 333
            :|.|:.:||||:::.:.||..|.:   :..:..:|| ..:::...::||.|:.||.|||.||:.|
Human   249 KFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRILKLARHSVGLRSL 313

  Fly   334 IQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPH-NDFNSIPLGLWWALVTMTTVGYGD 397
            ..|.|.|..|:.||:.||.:||.||:.|:|..|:   :.| :...|||:..|||.::||||||||
Human   314 GATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEK---DDHTSSLTSIPICWWWATISMTTVGYGD 375

  Fly   398 MAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYY 435
            ..|.|..|..:.:.|.:.|:|.:|||:.:|.:.|:.||
Human   376 THPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYY 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585 40/106 (38%)
BTB_2 27..117 CDD:280393 37/98 (38%)
Ion_trans 244..439 CDD:278921 76/197 (39%)
Ion_trans_2 355..429 CDD:285168 31/74 (42%)
KCNS3NP_001269357.1 BTB_2 17..116 CDD:280393 37/98 (38%)
BTB 44..122 CDD:197585 28/78 (36%)
Ion_trans 219..417 CDD:278921 77/205 (38%)
Ion_trans_2 329..411 CDD:285168 35/84 (42%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 370..375 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D818306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.