DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and KCNK3

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_002237.1 Gene:KCNK3 / 3777 HGNCID:6278 Length:394 Species:Homo sapiens


Alignment Length:283 Identity:58/283 - (20%)
Similarity:91/283 - (32%) Gaps:89/283 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 FEILVRFI--SSPNK----WEFIKSSVNIIDYIATLS----------------FY----IDLVLQ 297
            :|.|.|.:  ..|:|    |.|..|....|..|.|:.                ||    |.|.|.
Human    59 YEELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPLTLV 123

  Fly   298 RFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFF-----LVLGIVI 357
            .|.|..|           ||..|.:...|.:...:.::....|...:.|:.||     |.:|...
Human   124 MFQSLGE-----------RINTLVRYLLHRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAA 177

  Fly   358 FASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMA-----------PKTYIGMFVGAL 411
            |:             |.:..:.....::..:|:||:|:||..           |:.....||   
Human   178 FS-------------HYEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFV--- 226

  Fly   412 CALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGAPGGVSGCGTPG 476
            ..|.|:..|...:.::|..|....:..:.|   ..:.|.:|            ...|.:|.|..|
Human   227 YILTGLTVIGAFLNLVVLRFMTMNAEDEKR---DAEHRALL------------TRNGQAGGGGGG 276

  Fly   477 SGPH-----SGPMGSGGTGPRRM 494
            ...|     |....:||.|.|.:
Human   277 GSAHTTDTASSTAAAGGGGFRNV 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 45/221 (20%)
Ion_trans_2 355..429 CDD:285168 14/84 (17%)
KCNK3NP_002237.1 Ion_trans_2 <77..132 CDD:400301 14/65 (22%)
Ion_trans_2 167..247 CDD:400301 17/95 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 266..286 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 338..357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.