DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and RpL37b

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_611757.1 Gene:RpL37b / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster


Alignment Length:36 Identity:10/36 - (27%)
Similarity:14/36 - (38%) Gaps:11/36 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 RLFKLTRHSSG-----------LKILIQTFRASAKE 343
            |.|..:|.:.|           ||.|.:.||...:|
  Fly    45 RSFNWSRKAKGRKAQGTGRMRYLKNLRRRFRNGLRE 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 10/36 (28%)
Ion_trans_2 355..429 CDD:285168
RpL37bNP_611757.1 PTZ00073 1..89 CDD:240257 10/36 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.