DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and kcnd3

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:XP_005167059.1 Gene:kcnd3 / 327415 ZFINID:ZDB-GENE-030131-5626 Length:650 Species:Danio rerio


Alignment Length:454 Identity:162/454 - (35%)
Similarity:248/454 - (54%) Gaps:52/454 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYY 84
            |...:..::|||.|.|.:|::.||.:.|.|.|.. :|....::....||||||.|.||..:||:|
Zfish    35 NKRQDELIILNVSGRRFQTWRNTLDRYPDTLLGS-SEKEFFFNEETREYFFDRDPDVFRSILNFY 98

  Fly    85 RTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEE 149
            ||||||||...|...::|||.|:|:....:..||:..| :.|..:.|..::|  ||:..|.|:  
Zfish    99 RTGKLHYPRYECISAYDEELAFFGIIPEIISDCCYEEY-KDRKRENTERLMD--DLEDNKDSK-- 158

  Fly   150 LARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDM 214
             .....|.|               .:|..|:.|::|..|.....|:.|||.:|:::..::|.|..
Zfish   159 -LPNMTFRE---------------TMWRAFENPHTSTMALVFYYVTGFFIALSVITNVVETVPCG 207

  Fly   215 RVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSV 279
            .:|..|::.           ..:..|.   |||.::..|...||.|.|:|..::|:::.|::|.:
Zfish   208 YMPNQRDVP-----------CGERYTE---AFFCMDTACVMIFTVEYLMRLFAAPSRYRFMRSVM 258

  Fly   280 NIIDYIATLSFYIDLVLQRFASHLENADILEFF---SIIRIMRLFKLTRHSSGLKILIQTFRASA 341
            :|||.:|.|.:||.||:      ..|.|:...|   .:.|:.|:||.:|||.||:||..|.::.|
Zfish   259 SIIDVVAILPYYIGLVM------TNNEDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCA 317

  Fly   342 KELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGM 406
            .||..|:|.|.:.|:|||::::|||:  .:..:.|.|||...|:.:|||||:|||||.|||..|.
Zfish   318 SELGFLLFSLTMAIIIFATVMFYAEK--GSSSSKFTSIPASFWYTIVTMTTLGYGDMVPKTIAGK 380

  Fly   407 FVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGAPGGVS 470
            ..|::|:|:|||.||||||||||||:..| |...||    .:|:...|::.|..|:..:..|.|
Zfish   381 IFGSICSLSGVLVIALPVPVIVSNFSRIY-HQNQRA----DKRKAQKVQKARLARMRISKSGSS 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585 41/97 (42%)
BTB_2 27..117 CDD:280393 38/89 (43%)
Ion_trans 244..439 CDD:278921 88/197 (45%)
Ion_trans_2 355..429 CDD:285168 40/73 (55%)
kcnd3XP_005167059.1 Shal-type 3..28 CDD:288455
BTB 42..139 CDD:197585 41/98 (42%)
BTB_2 42..131 CDD:280393 38/89 (43%)
Ion_trans 213..411 CDD:278921 89/220 (40%)
Ion_trans_2 327..407 CDD:285168 45/81 (56%)
DUF3399 443..556 CDD:288712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.