DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and Kcnc2

DIOPT Version :10

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001346681.1 Gene:Kcnc2 / 268345 MGIID:96668 Length:642 Species:Mus musculus


Alignment Length:122 Identity:32/122 - (26%)
Similarity:44/122 - (36%) Gaps:38/122 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PGFGRSEPPAHSVT-YKLSNLARLVCSLITALGKSECVLVGNGAGSIIGW---HIVNQYP----- 168
            |||.|..||..||: .:||....:..|...||...:         .:..|   |..||:.     
Mouse    49 PGFQRRSPPQRSVSESELSRPGTVKLSKPVALWSQQ---------DVCKWLKKHCPNQHQVYSDS 104

  Fly   169 ----DRVSRYVM---------LGMSSEA----ILQQLYQ---RGAIPLATLLKSAFL 205
                |...|.:|         :|:..|:    ||||:.|   |..:....||..|.|
Mouse   105 FKQHDITGRALMRLTDRKLERMGIMQESQRQFILQQVLQLRVREEVRTLQLLTQASL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB_Shaw-like 24..135 CDD:349723 10/22 (45%)
Ion_trans 188..439 CDD:459842 6/21 (29%)
PRK14959 <418..>585 CDD:184923
Kcnc2NP_001346681.1 BTB_KCNC2_4 7..170 CDD:349722 32/122 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..98 16/57 (28%)
Ion_trans 232..488 CDD:459842
Selectivity filter. /evidence=ECO:0000250 441..446
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..576
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.