DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and Kcnq5

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001128115.2 Gene:Kcnq5 / 259273 RGDID:628848 Length:951 Species:Rattus norvegicus


Alignment Length:273 Identity:66/273 - (24%)
Similarity:114/273 - (41%) Gaps:58/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 VRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIID 283
            |:|..........||           ||.|...|....|...||..|.:.|...:...|.:.|::
  Rat   110 VQNYLYNVLERPRGW-----------AFVYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILE 163

  Fly   284 YIATLSFYIDLVLQ-----------------RFA------------------------SHLENAD 307
            ::..:.|.::.:::                 |||                        .::....
  Rat   164 FVMIVVFGLEFIIRIWSAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATS 228

  Fly   308 ILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFAS-LVYYAERIQPN 371
            .|.....::|:|:.::.|.....|:|.....|.:||| :..:::...::||:| |||..|:   :
  Rat   229 ALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKEL-ITAWYIGFLVLIFSSFLVYLVEK---D 289

  Fly   372 PHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYS 436
            .:.:|::....|||..:|:||:||||..|.|::|..:.|..||.|:...|||..::.|.||:...
  Rat   290 ANKEFSTYADALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQ 354

  Fly   437 HTQARAKLPKKRR 449
            . |.|.|..:|||
  Rat   355 E-QHRQKHFEKRR 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 56/236 (24%)
Ion_trans_2 355..429 CDD:285168 28/74 (38%)
Kcnq5NP_001128115.2 Ion_trans 159..357 CDD:278921 46/202 (23%)
Ion_trans_2 273..347 CDD:285168 28/76 (37%)
KCNQ_channel 471..659 CDD:281513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.