DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Shaw and rpl3702

DIOPT Version :9

Sequence 1:	NP_001137782.1	Gene:	Shaw / 33599	FlyBaseID:	FBgn0003386	Length:	619	Species:	Drosophila melanogaster
Sequence 2:	NP_588350.1	Gene:	rpl3702 / 2538715	PomBaseID:	SPCC1223.05c	Length:	91	Species:	Schizosaccharomyces pombe

Alignment Length:	55	Identity:	14/55 - (25%)
Similarity:	20/55 - (36%)	Gaps:	7/55 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   472 CGTPGSGPHSGPMGSGGTGPRRMNNKTKDLVSPKSVAQLF-----AGPLGASIVA 521
            ||.|.:...|  ...|....||....|..:...|.|.:.|     :|...|::.|
pombe    37 CGYPAAKTRS--YNWGAKAKRRRTTGTGRMSYLKKVHRSFKNGFRSGKPAAAVAA 89

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Shaw	NP_001137782.1	BTB	27..125	CDD:197585
		BTB_2	27..117	CDD:280393
		Ion_trans	244..439	CDD:278921
		Ion_trans_2	355..429	CDD:285168
rpl3702	NP_588350.1	PTZ00073	1..81	CDD:240257	11/45 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2126
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900