DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Shaw and Kcnk9

DIOPT Version :9

Sequence 1:	NP_001137782.1	Gene:	Shaw / 33599	FlyBaseID:	FBgn0003386	Length:	619	Species:	Drosophila melanogaster
Sequence 2:	XP_006520831.1	Gene:	Kcnk9 / 223604	MGIID:	3521816	Length:	604	Species:	Mus musculus

Alignment Length:	134	Identity:	31/134 - (23%)
Similarity:	47/134 - (35%)	Gaps:	51/134 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly   338 RASAKELTLLV---FFLVLGIVIFASL----------VYYAERI--------------------- 368
            |.:.:.|:|:.   .:|::|..:|.:|          ...||.:
Mouse   205 RQNVRTLSLIACTFTYLLVGAAVFDALESDHEMREEEKLKAEEVRLRGKYNISSDDYQQLELVIL 269

  Fly   369 QPNPHNDFNSIPLGLWW--------ALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVP 425
            |..||.      .|:.|        |:..:||:|||..||.|..|.   |.|....||.|.|.:.
Mouse   270 QSEPHR------AGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGK---AFCMFYAVLGIPLTLV 325

  Fly   426 VIVS 429
            :..|
Mouse   326 MFQS 329

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Shaw	NP_001137782.1	BTB	27..125	CDD:197585
		BTB_2	27..117	CDD:280393
		Ion_trans	244..439	CDD:278921	31/134 (23%)
		Ion_trans_2	355..429	CDD:285168	25/112 (22%)
Kcnk9	XP_006520831.1	Ion_trans_2	<279..334	CDD:400301	18/54 (33%)
Kcnk9	XP_006520831.1	Ion_trans_2	372..445	CDD:400301
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X19
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000