DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and twk-7

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_498903.3 Gene:twk-7 / 192073 WormBaseID:WBGene00006662 Length:557 Species:Caenorhabditis elegans


Alignment Length:150 Identity:41/150 - (27%)
Similarity:62/150 - (41%) Gaps:47/150 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 HSSGLKILIQTFRASA-KELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVT 389
            |..|..:.|:..|..| ..|.:|:.:...|.|:.:.|         .|.:.|.|    .:|:.:|
 Worm   356 HGMGHDMNIEEKRIPAFLVLAILIVYTAFGGVLMSKL---------EPWSFFTS----FYWSFIT 407

  Fly   390 MTTVGYGDMAPK---------TYI--GMFVGALCA-LAGVLTI---------------ALPV--- 424
            |||||:||:.|:         .||  |:.:..:|. |.||..|               ||.|   
 Worm   408 MTTVGFGDLMPRRDGYMYIILLYIILGLAITTMCIDLVGVQYIRKIHYFGRKIQDARSALAVVGG 472

  Fly   425 -PVIVSNFAMYYSHTQARAK 443
             .|:||.  :|.:..|.||:
 Worm   473 KVVLVSE--LYANLMQKRAR 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 38/144 (26%)
Ion_trans_2 355..429 CDD:285168 27/104 (26%)
twk-7NP_498903.3 Ion_trans_2 <263..321 CDD:285168
Ion_trans <371..>418 CDD:278921 18/59 (31%)
Ion_trans_2 377..>422 CDD:285168 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.