DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and kqt-3

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001254403.1 Gene:kqt-3 / 191699 WormBaseID:WBGene00002235 Length:621 Species:Caenorhabditis elegans


Alignment Length:297 Identity:66/297 - (22%)
Similarity:122/297 - (41%) Gaps:69/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 KPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLD 236
            :|..|..|...:|        |..:..||: |||                            .|.
 Worm    70 RPTGWKCFLYHFS--------VFLIVLICL-ILS----------------------------VLS 97

  Fly   237 KTQTNAHIA---FFYIECVCNAWFTFEILVR---------FISSPNKWEFIKSSVNIIDYIATLS 289
            ..:.::|.|   .:.:|.|...:|:.|.:||         :|....:.:|::..:.:||.:..:.
 Worm    98 TVEEHSHFAAELLYILEIVLVVFFSVEFIVRLWSAGCRSKYIGVYGRLKFVRKPITLIDLVVVIC 162

  Fly   290 FYIDLVL----QRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFF 350
            ....:..    |.||     |..:.....::|:|:..:.|.....::|........:||...::.
 Worm   163 SLFVICFGTEGQVFA-----ASAMRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYI 222

  Fly   351 LVLGIVIFASLVYYAER--IQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCA 413
            ..||::..:..||.||:  |..:....|.|....|||.::||||:||||:.|:|::|..|.:..:
 Worm   223 GFLGLIFSSYFVYLAEKDHIGVDGRQAFTSYADALWWGVITMTTIGYGDVVPQTWLGRIVASCFS 287

  Fly   414 LAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRR 450
            :..:...|||..::.|.||:         |:.:|:|:
 Worm   288 IFAISFFALPAGILGSGFAL---------KVQQKQRQ 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 51/212 (24%)
Ion_trans_2 355..429 CDD:285168 25/75 (33%)
kqt-3NP_001254403.1 Ion_trans 108..313 CDD:278921 51/218 (23%)
Ion_trans_2 224..303 CDD:285168 27/78 (35%)
KCNQ_channel <460..560 CDD:281513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.