DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and ZC239.4

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_494476.2 Gene:ZC239.4 / 191121 WormBaseID:WBGene00022567 Length:231 Species:Caenorhabditis elegans


Alignment Length:301 Identity:63/301 - (20%)
Similarity:101/301 - (33%) Gaps:111/301 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VVLNVGGIRHETYKATLKKIPATRLSRLTEALA-NYDPILNEYFFDRHPGVFAQVLNYYRTGKLH 90
            |.|:|||...:|.|:||.|......:.|...:. |.|. ....|.||.|..|..:||:.|.|.|.
 Worm     5 VKLDVGGTIFKTSKSTLTKFDGFFRTMLGSGIGLNVDE-SGCIFIDRSPKHFDLILNFMRDGCLA 68

  Fly    91 YPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFG 155
            .|.:                              .||..|.:|                      
 Worm    69 LPKN------------------------------ERDLTELMA---------------------- 81

  Fly   156 FEEDYY--KGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVV---SVFF--IC------ISILSFC 207
             |..||  .|.|   ..:....||:..:..:.|.||.:.::   |.|.  :|      :.|:...
 Worm    82 -EAQYYLLDGLI---DRLASSNWSVESDEKTINVAKRLPILENNSQFLQVLCNQEKPILLIVVMA 142

  Fly   208 LKTH--PDMRVPIVRNITVKTANGSNGW-FLDKTQTNAHIAFFYIECVCNAWF------------ 257
            .:.|  |:|.:|          :|.|.: |::|.....||  ::..|:|..|.            
 Worm   143 SRDHFFPNMSIP----------DGFNAYKFVEKYSHQFHI--YFKGCICLEWSARIIPKVKPRCN 195

  Fly   258 ----TFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDL 294
                |||..::.::..::.|         .||...|.|:::
 Worm   196 TKAPTFEGQMKRLNYSDRLE---------KYIEAYSTYLEM 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585 24/98 (24%)
BTB_2 27..117 CDD:280393 24/90 (27%)
Ion_trans 244..439 CDD:278921 12/67 (18%)
Ion_trans_2 355..429 CDD:285168
ZC239.4NP_494476.2 BTB_POZ 5..93 CDD:365784 33/144 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.