DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and twk-45

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001122742.2 Gene:twk-45 / 190614 WormBaseID:WBGene00006695 Length:508 Species:Caenorhabditis elegans


Alignment Length:401 Identity:75/401 - (18%)
Similarity:142/401 - (35%) Gaps:136/401 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LDLDTEKPSEEELAR---KFGFEEDYYKGTISWWQEMKPRI----------WSLFDEPYSSNAAK 189
            |.:||.....|:::.   .|.|:|..||       |.|.:|          |..:  .:.....:
 Worm    30 LKIDTHMGKVEDMSPFGFHFEFDEKKYK-------ERKKQIRREKITWFFAWLAY--YHHKFGIR 85

  Fly   190 TIGVVSVF--FIC--------------ISILSFCLKTHPDMRVPIVRNITVK------TANGSNG 232
            .|.::|:.  :||              |..|...||:..:    |::|.|:.      |.||.  
 Worm    86 HITLISILAAYICLGGFLFQKLESPREIEELQETLKSMNE----IIKNETMDIIKITLTTNGE-- 144

  Fly   233 WFLDKTQTNAHIAFFYIECVC--------NAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLS 289
               |:.|....:...|...:.        :||...|.|               .:|::.|.::.:
 Worm   145 ---DRNQKLGDLLRAYHRILLETEGKFHGSAWHKSENL---------------DMNLMWYFSSAT 191

  Fly   290 FY----------------------IDLVLQRFAS------HLENADILEFFSIIRIMR---LFKL 323
            ||                      :.:|   :||      .|...||..:|.  ::|.   :|.:
 Worm   192 FYSMTLFSTIGYGTITCQTFWGKTVSMV---YASIGLPIMLLVLGDIGVWFQ--KVMTNAYIFVM 251

  Fly   324 TRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFA-------SLVYYAERIQPNPHNDFNSIPL 381
            .::.|..|   |:.....|| |||..:|.: :|:|.       :::.:.:.....|..:|..   
 Worm   252 LKYKSLRK---QSIEIKRKE-TLLPMWLAM-LVVFTYIIICTLTILLFDDNEGDEPGINFFD--- 308

  Fly   382 GLWWALVTMTTVGYGDMAPKTY-------IGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQ 439
            ..::..:::||:|.||:.|...       :...:|  .||..::..::...:..|.:.:.||...
 Worm   309 AFYFTFISLTTIGLGDVMPYNIQYSPFLPLAFLLG--LALISIVNTSIYSTLYQSFYNLIYSLED 371

  Fly   440 ARAKLPKKRRR 450
            ...::...|||
 Worm   372 QLDRIHNSRRR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 43/247 (17%)
Ion_trans_2 355..429 CDD:285168 13/87 (15%)
twk-45NP_001122742.2 Ion_trans_2 <185..241 CDD:285168 10/60 (17%)
Ion_trans_2 278..354 CDD:285168 13/80 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.