DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and kqt-2

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_509392.3 Gene:kqt-2 / 181078 WormBaseID:WBGene00002234 Length:695 Species:Caenorhabditis elegans


Alignment Length:312 Identity:72/312 - (23%)
Similarity:130/312 - (41%) Gaps:78/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LDLDTEKPSEEELARKFGFEEDYYKGTISWWQE-------MKPRIWSLFDEPYSSNAAKTIGVVS 195
            |.:|..:.||.|::     :....:.||:...:       ::.::::..::|.::.:|.     .
 Worm    42 LTIDDAEDSETEVS-----DNIRRRSTINLGNQRQRNLRRIRLKVYNFLEKPLNAASAP-----Y 96

  Fly   196 VFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFE 260
            .|||      |.|         ::.||.:..|...|    |.|.:..|   |::|.....:|..|
 Worm    97 HFFI------FGL---------VIANIILGAATNDN----DSTVSKIH---FFLEIFMIVFFILE 139

  Fly   261 ILVRF--ISSPNKWE-------FIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIR 316
            ..||.  :.:..|:.       ::..:|.:||.:...:..:.||   |..|..:...|:....|:
 Worm   140 FAVRLWSVRADAKYRTKYGRLYYLFHTVTLIDILIIPATILLLV---FKGHDVDGSTLDTLRFIQ 201

  Fly   317 IMRLFKLTRHSSGLKILIQTFRASAKELTLLVFF-LVLGIVIFASLVY----YAERIQPNPHN-- 374
            |:|||.:.|..:..|:|.:.......:|....:. ||:|:.: |::||    .|:.||.|.:.  
 Worm   202 ILRLFHVDRQMATWKLLRKMIILGKWQLMATYYITLVVGLSL-ATIVYSTEALAQGIQDNGYGLI 265

  Fly   375 -------DFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGAL-----CAL 414
                   .|.::....|:..||:.||||||:.|       ||||     |.|
 Worm   266 VPEGTNATFPTMAHSWWFTAVTVMTVGYGDIYP-------VGALTKFLVCVL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 51/199 (26%)
Ion_trans_2 355..429 CDD:285168 24/78 (31%)
kqt-2NP_509392.3 Ion_trans 96..318 CDD:366146 63/248 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.