DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and twk-9

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001294002.1 Gene:twk-9 / 177803 WormBaseID:WBGene00006664 Length:568 Species:Caenorhabditis elegans


Alignment Length:158 Identity:38/158 - (24%)
Similarity:61/158 - (38%) Gaps:41/158 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 SIPLGLWWALVTMTTVGYGDMAPKTYIG----MFVGALCALAGVLTIALPVPVIVSNFAMYYSH- 437
            ||...:.:|...:||:|||.:||:|:.|    :|.|.:.....:||||        :..|:.:. 
 Worm   162 SIGNSVIFAFTVITTIGYGHVAPETFEGRLFLIFYGVIGVPFTLLTIA--------DLGMFLTRF 218

  Fly   438 -----TQAR------AKLPKKRRRVLPVEQPRQPRLPGAP-GGVSGCG------------TPGSG 478
                 |.||      .||.:|.::.....|...|.:|.:. ..|...|            .||.|
 Worm   219 LKNLLTMARRFAHYLVKLYQKAKKQRNKSQKTSPVMPDSERSEVWNTGKEMKEMSMRTAREPGEG 283

  Fly   479 PHSGPMGSGGTGPRRMNNKTKDLVSPKS 506
            .....:.:|..    .|.|.:|...|::
 Worm   284 DEIEVIENGND----ENGKEEDEEEPEN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 19/70 (27%)
Ion_trans_2 355..429 CDD:285168 18/54 (33%)
twk-9NP_001294002.1 Ion_trans_2 <159..217 CDD:285168 19/62 (31%)
Ion_trans_2 321..397 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.