DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and F18A11.5

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001254362.1 Gene:F18A11.5 / 174943 WormBaseID:WBGene00008932 Length:231 Species:Caenorhabditis elegans


Alignment Length:189 Identity:50/189 - (26%)
Similarity:76/189 - (40%) Gaps:57/189 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RVVLNVGGIRHETYKATLKKIPATRLS-RLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKL 89
            ||:|||||.:.||..|||.::..|.|: .:::.....|    |.|.||.|..|.:||||.|.|. 
 Worm    21 RVLLNVGGKKFETTVATLTRVSDTVLAVMVSDRWKTGD----EIFIDRDPKHFGKVLNYLRDGD- 80

  Fly    90 HY----PTDVCGPLFEEELEF----------------------WGLDSNQVEPCCWMTYTQHR-- 126
            |:    .|:.|..| :.|..|                      |..|:.::   .|..:.::.  
 Worm    81 HFVAPSDTEACDEL-KREAHFYNMPFLAEMCMPMNVDVADVVQWKRDAIEI---YWRPFVRYMVD 141

  Fly   127 DTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSS 185
            |:.....:.||        :...|||....||         :|:  |:...|||..|::
 Worm   142 DSLSLPFIYDR--------NNHTLARCIACEE---------FQD--PKCSYLFDINYTA 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585 35/124 (28%)
BTB_2 27..117 CDD:280393 34/116 (29%)
Ion_trans 244..439 CDD:278921
Ion_trans_2 355..429 CDD:285168
F18A11.5NP_001254362.1 BTB_POZ 22..102 CDD:365784 32/85 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.