DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and shk-1

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_871935.1 Gene:shk-1 / 174536 WormBaseID:WBGene00014261 Length:536 Species:Caenorhabditis elegans


Alignment Length:442 Identity:150/442 - (33%)
Similarity:233/442 - (52%) Gaps:70/442 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPG------------VFAQ 79
            |.:||.|:|.:|:::||.:.|.:.|....:....:....||:|||||..            :|..
 Worm   135 VTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTSSSFTFEIRNYLFES 199

  Fly    80 VLNYYRT-GKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMT--YTQHRDTQETLAVLDRLDLD 141
            :|..|:: |::..|..|...:|.:|:.|:.:..:.:|. .|:.  |                   
 Worm   200 ILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEE-FWIAEGY------------------- 244

  Fly   142 TEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSF 206
             |||.|..:..                .:.:.:||.|.:.|.||.:|:.|..:|:..|.:||:||
 Worm   245 -EKPKEVMMPN----------------NKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISF 292

  Fly   207 CLKTHPDMRVPIVRNITVKTANGS-NGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPN 270
            |.:|.|.       :|..|..|.| ....||:.....:..||:||.:|..|||.|:::||||.|.
 Worm   293 CWETVPS-------DIEEKPINNSATAELLDEMDEKHYSPFFWIELMCILWFTIELILRFISCPC 350

  Fly   271 KWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENAD-----ILEFFSIIRIMRLFKLTRHSSGL 330
            |..|..|.:||||::|...|:::..   ||...::..     :|....::|:.|:|||:|||.||
 Worm   351 KVTFATSVLNIIDFVAIAPFFVNFF---FADTSKSNSSMSFAVLRVLRLVRVFRVFKLSRHSVGL 412

  Fly   331 KILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGY 395
            :||.:|||:|.:|..||:||:.:.:|:|||.:|:||:.:||  :.|.|||...|:.|||||||||
 Worm   413 QILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPN--SKFTSIPASFWFVLVTMTTVGY 475

  Fly   396 GDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKK 447
            ||:.|.:..|..||.:||:.||||:|||||:||:||..:|......|.:..|
 Worm   476 GDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQENRLASMKSK 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585 29/112 (26%)
BTB_2 27..117 CDD:280393 27/102 (26%)
Ion_trans 244..439 CDD:278921 92/199 (46%)
Ion_trans_2 355..429 CDD:285168 41/73 (56%)
shk-1NP_871935.1 BTB 135..238 CDD:197585 27/103 (26%)
BTB_2 135..238 CDD:280393 27/103 (26%)
Ion_trans 318..519 CDD:278921 92/205 (45%)
Ion_trans_2 432..504 CDD:285168 38/73 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.