Sequence 1: | NP_001137782.1 | Gene: | Shaw / 33599 | FlyBaseID: | FBgn0003386 | Length: | 619 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_494195.3 | Gene: | C40A11.4 / 173571 | WormBaseID: | WBGene00016547 | Length: | 228 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 45/196 - (22%) |
---|---|---|---|
Similarity: | 69/196 - (35%) | Gaps: | 59/196 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 MDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFF-DRHPGVFAQVLNYY 84
Fly 85 RTGKLHYP------TDVCGPLFEEELEFWGLDSNQVEPCC---WMTYTQHRDTQETLAVLDRLDL 140
Fly 141 DTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRI--------WSLFDEPYSSNAAKTIGVVSVF 197
Fly 198 F 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Shaw | NP_001137782.1 | BTB | 27..125 | CDD:197585 | 30/107 (28%) |
BTB_2 | 27..117 | CDD:280393 | 28/96 (29%) | ||
Ion_trans | 244..439 | CDD:278921 | |||
Ion_trans_2 | 355..429 | CDD:285168 | |||
C40A11.4 | NP_494195.3 | BTB | 7..90 | CDD:383002 | 28/94 (30%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |