DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and Kcns1

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_032461.2 Gene:Kcns1 / 16538 MGIID:1197019 Length:497 Species:Mus musculus


Alignment Length:442 Identity:138/442 - (31%)
Similarity:226/442 - (51%) Gaps:54/442 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LNVGGIRHETYKATLKKIPATRLSRLTEALA---------NYDPILNEYFFDRHPGVFAQVLNYY 84
            :||||:|.......|.:.|.|||.||..|.:         :||...:|::||||||.|..:|::|
Mouse    23 VNVGGVRRLLSARALARFPGTRLGRLQAAASEEQARRLCDDYDAAAHEFYFDRHPGFFLGLLHFY 87

  Fly    85 RTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPS--- 146
            |||.||...::|...|.:|.::|||..|.:..||...|.:.|     :|.....|.|::.||   
Mouse    88 RTGHLHVLDELCVFAFGQEADYWGLGENALATCCRARYLERR-----VARPRAWDEDSDAPSSVD 147

  Fly   147 ---------EEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICIS 202
                     :.|||| :|         .:....::.|:|...:.|..|..:|....||:..:..|
Mouse   148 PCPDEISDVQRELAR-YG---------AARCGRLRRRLWLTMENPGYSLPSKLFSCVSIGVVLAS 202

  Fly   203 ILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFIS 267
            |.:.|:.:.|:.:   .|......|..:.|...::.:.:..:.  .:|..|.|||:||:..|.:.
Mouse   203 IAAMCIHSLPEYQ---AREAAAAVAAVAAGRSAEEVRDDPVLR--RLEYFCIAWFSFEVSSRLLL 262

  Fly   268 SPNKWEFIKSSVNIIDYIATLSFYIDLVL------QRFASHLENAD---ILEFFSIIRIMRLFKL 323
            :|:...|....:|:||.::.|.||:.|:.      ||.||..|..|   :::.|.::||.|:.||
Mouse   263 APSTRNFFCHPLNLIDIVSVLPFYLTLLAGAALGDQRGASGEELGDLGKVVQVFRLMRIFRVLKL 327

  Fly   324 TRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALV 388
            .|||:||:.|..|.:.|.:|:.:|:.:|.:|:.:|:.:.|.||    ..:..|::||...||..|
Mouse   328 ARHSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAE----EENEGFHTIPACWWWGTV 388

  Fly   389 TMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQA 440
            :||||||||:.|:|..|....:.|.|.|:|.:|||:.:|.:.|:.:|...:|
Mouse   389 SMTTVGYGDVVPETVGGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKA 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585 40/104 (38%)
BTB_2 27..117 CDD:280393 37/96 (39%)
Ion_trans 244..439 CDD:278921 72/203 (35%)
Ion_trans_2 355..429 CDD:285168 29/73 (40%)
Kcns1NP_032461.2 BTB_POZ 21..126 CDD:365784 39/102 (38%)
Ion_trans 188..439 CDD:395416 82/259 (32%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 392..397 4/4 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 464..497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.