DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and Kcnk15

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_570826.1 Gene:Kcnk15 / 156873 RGDID:619733 Length:318 Species:Rattus norvegicus


Alignment Length:393 Identity:75/393 - (19%)
Similarity:119/393 - (30%) Gaps:150/393 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 AVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVF 197
            ||.|.|:.:.|:..:..||||.|.....|:.:...::|:: |: :|..||:  .|.:.......|
  Rat    24 AVFDALESEAERSRQRLLARKRGEFRRKYRFSADDYRELE-RL-ALQAEPH--RAGRQWRFAGSF 84

  Fly   198 FICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEIL 262
            :..|::::                 |:...:.:.|     |.:......||              
  Rat    85 YFAITVIT-----------------TIGYGHAAPG-----TDSGKVFCMFY-------------- 113

  Fly   263 VRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTR-H 326
                                   |.|.  |.|.|..|.|..|..:.|....::...|...|.| |
  Rat   114 -----------------------ALLG--IPLTLVTFQSLGERLNALVRCLLLAAKRCLGLRRPH 153

  Fly   327 SSGLKILIQTFRASAKELTLLVFFLVLGIVIFASL-------VYYAERIQPNPHNDFNSIPLGLW 384
            .|...:::       ..|.|....|.||...||..       .||                    
  Rat   154 VSAENMVV-------AGLLLCAATLALGAAAFAHFEGWTFFHAYY-------------------- 191

  Fly   385 WALVTMTTVGYGDMA----------PKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQ 439
            :..:|:||:|:||..          ...|:..  ..|..|.|:..|...:.::|..|.       
  Rat   192 YCFITLTTIGFGDFVALQRDEALQKKPPYVAF--SFLYILLGLTVIGAFLNLVVLRFL------- 247

  Fly   440 ARAKLPKKR--------RRVLPVEQPRQP----------------RLPGAPGGVSGCGTPGSGPH 480
            |.|:.|::.        ||..|..:.|.|                ..|.:|..|..|       |
  Rat   248 ASAEAPERAALRRASVFRRGAPESRVRIPYPFHPLETWARDNPAFSPPLSPEAVHDC-------H 305

  Fly   481 SGP 483
            |.|
  Rat   306 SSP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 38/212 (18%)
Ion_trans_2 355..429 CDD:285168 15/90 (17%)
Kcnk15NP_570826.1 Ion_trans_2 <77..132 CDD:285168 15/115 (13%)
Ion_trans_2 <182..243 CDD:285168 13/82 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..318 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.