DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and AgaP_AGAP000478

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:XP_310614.4 Gene:AgaP_AGAP000478 / 1271761 VectorBaseID:AGAP000478 Length:324 Species:Anopheles gambiae


Alignment Length:93 Identity:29/93 - (31%)
Similarity:44/93 - (47%) Gaps:6/93 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SENRVVLNVGGIRHETYKATL-KKIPATRLSRLTEALANYDPILNE----YFFDRHPGVFAQVLN 82
            :|..|.|||||....|.:.|| .:.|.:.::|:. |.....|...:    |..||:...|..:|:
Mosquito    33 AERWVTLNVGGEIFTTTRLTLTNREPNSMIARMF-AQDQLKPAEQDGQGAYLIDRNGHYFRPILD 96

  Fly    83 YYRTGKLHYPTDVCGPLFEEELEFWGLD 110
            |.|.|::.|...|......||..::|||
Mosquito    97 YLRHGRVIYDPHVSLQGILEEARYYGLD 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585 28/89 (31%)
BTB_2 27..117 CDD:280393 28/89 (31%)
Ion_trans 244..439 CDD:278921
Ion_trans_2 355..429 CDD:285168
AgaP_AGAP000478XP_310614.4 BTB 36..133 CDD:197585 28/90 (31%)
BTB 37..127 CDD:295341 28/89 (31%)
Pentapeptide_4 159..235 CDD:290330
Pentapeptide 160..196 CDD:279183
Pentapeptide 183..215 CDD:279183
Pentapeptide 223..257 CDD:279183
Pentapeptide_4 234..310 CDD:290330
Pentapeptide 268..307 CDD:279183
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.