| Sequence 1: | NP_001137782.1 | Gene: | Shaw / 33599 | FlyBaseID: | FBgn0003386 | Length: | 619 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_308719.3 | Gene: | AgaP_AGAP007044 / 1270057 | VectorBaseID: | AGAP007044 | Length: | 333 | Species: | Anopheles gambiae |
| Alignment Length: | 88 | Identity: | 28/88 - (31%) |
|---|---|---|---|
| Similarity: | 43/88 - (48%) | Gaps: | 7/88 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 27 VVLNVGGIRHETYKATLKKIPATRLSRLTEALAN--YDPILNEYFFDRHPGVFAQVLNYYRTGKL 89
Fly 90 HYPTDVCGP---LFEEELEFWGL 109 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Shaw | NP_001137782.1 | BTB | 27..125 | CDD:197585 | 28/88 (32%) |
| BTB_2 | 27..117 | CDD:280393 | 28/88 (32%) | ||
| Ion_trans | 244..439 | CDD:278921 | |||
| Ion_trans_2 | 355..429 | CDD:285168 | |||
| AgaP_AGAP007044 | XP_308719.3 | BTB | 102..195 | CDD:197585 | 28/88 (32%) |
| BTB | 102..189 | CDD:295341 | 28/88 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||