DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and Kcnq3

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_690887.2 Gene:Kcnq3 / 110862 MGIID:1336181 Length:873 Species:Mus musculus


Alignment Length:286 Identity:71/286 - (24%)
Similarity:118/286 - (41%) Gaps:36/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 KPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLD 236
            :||.|:|.   |.:         .||.|.:..|...:.|            |.|.....:|.:|.
Mouse   118 RPRGWALL---YHA---------LVFLIVLGCLILAVLT------------TFKEYETVSGDWLL 158

  Fly   237 KTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFAS 301
            ..:|.| |..|..|.....| ......|:.....:.:|.:..:.::|....::....:.:....:
Mouse   159 LLETFA-IFIFGAEFALRIW-AAGCCCRYKGWRGRLKFARKPLCMLDIFVLIASVPVVAVGNQGN 221

  Fly   302 HLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAE 366
            .|  |..|.....::|:|:.::.|.....|:|.....|.:|||....:...|.:::.:.|||..|
Mouse   222 VL--ATSLRSLRFLQILRMLRMDRRGGTWKLLGSAICAHSKELITAWYIGFLTLILSSFLVYLVE 284

  Fly   367 RIQP-------NPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPV 424
            :..|       ....:|.:....|||.|:|:.|:||||..|||:.|..:.|..:|.||...|||.
Mouse   285 KDVPEMDAQGEEMKEEFETYADALWWGLITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPA 349

  Fly   425 PVIVSNFAMYYSHTQARAKLPKKRRR 450
            .::.|..|:.... |.|.|..:|||:
Mouse   350 GILGSGLALKVQE-QHRQKHFEKRRK 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 49/201 (24%)
Ion_trans_2 355..429 CDD:285168 27/80 (34%)
Kcnq3NP_690887.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
Ion_trans 140..364 CDD:278921 56/240 (23%)
Ion_trans_2 270..354 CDD:285168 28/83 (34%)
Selectivity filter. /evidence=ECO:0000250 317..322 3/4 (75%)
Mediates interaction with calmodulin. /evidence=ECO:0000250|UniProtKB:O43525 357..538 7/19 (37%)
KCNQ_channel 453..657 CDD:281513
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 575..603
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 723..742
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 766..873
KCNQC3-Ank-G_bd 781..867 CDD:288784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.