DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and kcnk4a

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:XP_021336981.1 Gene:kcnk4a / 101885817 ZFINID:ZDB-GENE-141211-80 Length:485 Species:Danio rerio


Alignment Length:318 Identity:61/318 - (19%)
Similarity:100/318 - (31%) Gaps:131/318 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 RASAKELTLL---------------VFFLVLGIVIFASLVYYAERIQPNPHNDFN-----SIPLG 382
            ||.||..||.               ||.:::|.::|.::          |...|.     |:...
Zfish    88 RAVAKVETLFLRKGVKPTSVRIISAVFSILIGCLVFIAV----------PTMVFQEVESWSLLEA 142

  Fly   383 LWWALVTMTTVGYGDMA------------PKTYIGMFVGALCALAGVLTI--------------- 420
            :::.::|:||||:||..            |..::.:..| |...|.:||:               
Zfish   143 VYFVVITLTTVGFGDYVAENRRDGTPLYKPLVWLWIVFG-LAYFASILTMIGNWLRVLSKKTRAE 206

  Fly   421 ----------------------ALPVPVIVSNFAMYYSHTQARAKLPKKRRRVL------PVEQP 457
                                  .:|||:.:::          ..:|.::|||..      ....|
Zfish   207 MEELRAHATDWTQNIQNMSMDFRIPVPLDLND----------PFQLQRRRRRKRHHHHHHHHRHP 261

  Fly   458 RQPRLPGAPGGVS--------------GCGTPGSGPHSGPMGSGGTGPRRMNNKTKDLVSPKSVA 508
            | |...|...|:|              |..|....|.|..:...    |.|:.........:..:
Zfish   262 R-PNTTGLTHGISLDADIIRENGHLILGWPTCRYKPASEVLSQS----RSMSRIDGAHYEMRPGS 321

  Fly   509 QLFAGPLGASIVAMSPRTMLDLNPALAMGKPTFQPRIPTPLAATPPPPVSSAGGMTAS 566
            :|..||...||      :.|:|.||...|.          .|.:..|..|.:|..:||
Zfish   322 RLTVGPTSRSI------SRLELKPASRAGS----------RAISRSPSQSESGSFSAS 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 29/169 (17%)
Ion_trans_2 355..429 CDD:285168 20/127 (16%)
kcnk4aXP_021336981.1 Ion_trans_2 24..80 CDD:311712
Ion_trans_2 116..197 CDD:311712 18/91 (20%)
THRAP3_BCLAF1 329..>419 CDD:317794 13/51 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.